KEGG   Pongo abelii (Sumatran orangutan): 100442719
Entry
100442719         CDS       T01416                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X1
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04064  NF-kappa B signaling pathway
pon04071  Sphingolipid signaling pathway
pon04210  Apoptosis
pon04217  Necroptosis
pon04622  RIG-I-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04668  TNF signaling pathway
pon04920  Adipocytokine signaling pathway
pon05132  Salmonella infection
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100442719 (TRADD)
   04064 NF-kappa B signaling pathway
    100442719 (TRADD)
   04668 TNF signaling pathway
    100442719 (TRADD)
   04071 Sphingolipid signaling pathway
    100442719 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100442719 (TRADD)
   04217 Necroptosis
    100442719 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100442719 (TRADD)
   04657 IL-17 signaling pathway
    100442719 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100442719 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100442719 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100442719 (TRADD)
   05152 Tuberculosis
    100442719 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100442719 (TRADD)
   05160 Hepatitis C
    100442719 (TRADD)
   05164 Influenza A
    100442719 (TRADD)
   05162 Measles
    100442719 (TRADD)
   05168 Herpes simplex virus 1 infection
    100442719 (TRADD)
   05163 Human cytomegalovirus infection
    100442719 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100442719 (TRADD)
   05169 Epstein-Barr virus infection
    100442719 (TRADD)
   05165 Human papillomavirus infection
    100442719 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 100442719
NCBI-ProteinID: XP_024089129
LinkDB
Position
16
AA seq 311 aa
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQRSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAQGGDGEVASAPL
QPPVPSLLEVKPPPPPPAQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLTDPNGGLA
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgggtgggcagtgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggca
gtgtacagggctctgcaggctgccttggcagagagcggcgggagcccggacgtgctgcag
atgctgaagatccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcgg
cagccctgtggccgtttcctccgcgcctaccgcgagggggcgctgcgcgccgcgctgcag
aggagcctggcggccgcgctcgcccagcgctcggtgccgctgcaactggagctgcgcgcc
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgagttgcatccta
gcccagcagcccgaccggctccgggatgaagaactggctgagctggaggatgcgctgcga
aatctgaagtgcggctcaggggcccagggtggcgacggggaggtcgcttcggcccccttg
cagcccccggtgccctctctgttggaggtgaagccgccgccgccgccacctgcccagact
tttctgttccagggtcagcctgtagtgaaccggccgctgagcctgcaggaccaacaaacg
ttcgcgcgctccgtgggcctcaaatggcgcaaggtggggcgctcactgcagcgaggctgc
cgggcgctgcgggacccggcgctggactcgctggcctacgagtacgagcgcgagggactg
tacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgccacg
ctgcagcgcctggtggaggcactcgaggagaacgagctcaccagcctggcagaggacttg
ctgggcctgaccgatcccaatggcggcctggcctag

DBGET integrated database retrieval system