KEGG   Pongo abelii (Sumatran orangutan): 100442753
Entry
100442753         CDS       T01416                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X3
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05012  Parkinson disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05142  Chagas disease
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100442753 (GNAS)
   04020 Calcium signaling pathway
    100442753 (GNAS)
   04072 Phospholipase D signaling pathway
    100442753 (GNAS)
   04024 cAMP signaling pathway
    100442753 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100442753 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100442753 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    100442753 (GNAS)
   04922 Glucagon signaling pathway
    100442753 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    100442753 (GNAS)
   04912 GnRH signaling pathway
    100442753 (GNAS)
   04913 Ovarian steroidogenesis
    100442753 (GNAS)
   04915 Estrogen signaling pathway
    100442753 (GNAS)
   04921 Oxytocin signaling pathway
    100442753 (GNAS)
   04926 Relaxin signaling pathway
    100442753 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    100442753 (GNAS)
   04918 Thyroid hormone synthesis
    100442753 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    100442753 (GNAS)
   04916 Melanogenesis
    100442753 (GNAS)
   04924 Renin secretion
    100442753 (GNAS)
   04925 Aldosterone synthesis and secretion
    100442753 (GNAS)
   04927 Cortisol synthesis and secretion
    100442753 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100442753 (GNAS)
   04270 Vascular smooth muscle contraction
    100442753 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    100442753 (GNAS)
   04971 Gastric acid secretion
    100442753 (GNAS)
   04972 Pancreatic secretion
    100442753 (GNAS)
   04976 Bile secretion
    100442753 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100442753 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100442753 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    100442753 (GNAS)
   04728 Dopaminergic synapse
    100442753 (GNAS)
   04726 Serotonergic synapse
    100442753 (GNAS)
   04730 Long-term depression
    100442753 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100442753 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100442753 (GNAS)
   04714 Thermogenesis
    100442753 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100442753 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100442753 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    100442753 (GNAS)
   05031 Amphetamine addiction
    100442753 (GNAS)
   05032 Morphine addiction
    100442753 (GNAS)
   05034 Alcoholism
    100442753 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100442753 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100442753 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100442753 (GNAS)
   05165 Human papillomavirus infection
    100442753 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100442753 (GNAS)
   05142 Chagas disease
    100442753 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100442753 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100442753 (GNAS)
   04031 GTP-binding proteins [BR:pon04031]
    100442753 (GNAS)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100442753 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   100442753 (GNAS)
  Exosomal proteins of colorectal cancer cells
   100442753 (GNAS)
  Exosomal proteins of bladder cancer cells
   100442753 (GNAS)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100442753 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA
Other DBs
NCBI-GeneID: 100442753
NCBI-ProteinID: XP_002830517
Ensembl: ENSPPYG00000011177
LinkDB
Position
20
AA seq 1046 aa
MGVRNCLDGNHMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIP
IENDGEVCGPPEVSRPNFQVLNPAFREAGAHGSYSPPPEEAMPFEVEQTSLGSFWPTLEQ
PGFPSGAHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRSCSQLLSQ
VPDLAPGGPGAAGVPGAPPEEPQAFGPAKADSRGGYSPPPEETMPFELDGEGFGDDSPPP
GLSGVIAQVDGSGQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSREAVRPPSNFTGSSP
WMEISGPPLEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEEAADAAEGGKVPSPGYGSPAAGAASADAAAGAASADTAARAAPAAPADPDSGAAPEDP
DSGTAPADPDSGAAPADPDSGAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDSGAAP
DAPAAPAAAETRAAPVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPP
SPEIQAADPPTPRPTRASAWRGKSESSRGRRGYYDEGAASSDDDSSGDESDDGTSGCFRW
FQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKASRFFKVKKVPLAEKRRQMRKE
ALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGF
NGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRV
DYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQA
DYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVV
ASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKI
EDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVD
TENIRRVFNDCRDIIQRMHLRQYELL
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgggcgtgcgcaactgcctcgacggcaatcatatgtcaggacaacgcgatatcccccct
gaaatcggggaacagcccgagcaaccacctttggaggccccaggggcagctgcccccggt
gctgggcctagcccagccgaagagatggagaccgaaccgcctcacaacgagcccatcccc
atcgagaatgacggcgaggtctgtggacccccagaggtctccagacccaactttcaggtc
ctcaacccggcattcagggaagctggagcccatggaagctacagcccacctcctgaggaa
gcaatgcccttcgaggttgaacagaccagcttgggaagcttctggcctacactggagcag
cctggattccccagtggggcccatgcaggccttgaggccttcggcccagcactcatggag
cccggagccttcagtggtgccagaccaggcctgggaggatacagccctccaccagaagaa
gctatgccctttgagtttgaccagcctgcccagagaagctgcagtcaacttctctcacag
gtcccagaccttgctccaggaggcccaggtgctgcaggggtccccggagctcctcccgag
gagccccaagccttcgggcctgcaaaggctgactccagaggaggctacagccctccccct
gaggagactatgccatttgagcttgatggagaaggatttggagacgacagcccacccccg
gggctttccggagttatcgcacaagtcgacggcagcggccagttcgcggcagtcgcggcc
tcgagtgcggtccgcctcactcccgccgcgaacgcgcctcccctctgggtcccaggcgcc
atcggcagcccatcccgagaggctgtcagacctccttctaacttcacgggcagcagcccc
tggatggagatctccggacccccgctcgagattggcagcgcccccgctggggtcgacgac
actcccgtcaacatggacagccccccaatcgcgcttgacggcccgcccatcaaggtctcc
ggagccccagataagagagagcgagcagagagacccccagttgaggaagaagcagcagag
atggaagaagccgctgatgccgcggagggaggaaaagtcccctctccggggtacggatcc
cctgccgccggggcagcctcagcggatgccgccgctggggcagcctcagcggataccgct
gccagggcagcccctgcagccccagccgatcctgactccggggcagccccagaagatccc
gactccgggacagcaccagccgatcctgactccggggcagccccagccgatcccgactcc
ggggcagcccctgccgccccagccgatcccgactccggggcggcccctgacgccccagcc
gatcccgactccggggcggcccctgacgccccagccgatcccgactccggggcggcccct
gacgctcccgccgcccctgcggctgctgagacccgggcagcccctgtcgccccagctgcg
ccagacgcaggggctcccactgccccagccgcttctgccacccgggcagcccaagtccgc
cgggcggcctccgcagcccctgcctccggggccagacgcaagatccatctcagacccccc
agccccgagatccaggctgccgatccgcctactccgcggcctactcgcgcgtctgcctgg
cggggcaagtccgagagcagccgcggccgccgcgggtactacgatgaaggggcggccagc
agcgacgatgactccagcggagacgagtccgacgatgggacctccggatgcttccgctgg
tttcagcatcggcgaaatcgccgccgccgaaagccccagcgcaacttactccgcaacttc
ctcgtgcaagccttcgggggctgcttcggtcgatctgagagtccccagcccaaagcctcg
cgctttttcaaggtcaagaaggtacccctggcggagaagcgcagacagatgcgcaaagaa
gccctggagaagcgggcccagaagcgcgcagagaagaaacgcagtaagctcatcgacaaa
caactccaggacgaaaagatgggctacatgtgtacgcaccgcctgctgcttctaggtgct
ggagaatctggtaaaagcaccattgtgaagcagatgaggatcctgcatgttaatgggttt
aatggagagggcggcgaagaggacccgcaggctgcaaggagcaacagcgatggtgagaag
gcaaccaaagtgcaggacatcaaaaacaacctgaaagaggcgattgaaaccattgtggcc
gccatgagcaacctggtgccccccgtggagctggccaaccccgagaaccagttcagagtg
gactacattctgagtgtgatgaacgtgcctgactttgacttccctcccgaattctatgag
cacgccaaggctctgtgggaggatgaaggagtgcgtgcctgctacgaacgctccaacgag
taccagctgattgactgtgcccagtacttcctggacaagatcgatgtgatcaagcaggct
gactatgtgccgagcgatcaggacctgcttcgctgccgcgtcctgacttctggaatcttt
gagaccaagttccaggtggacaaagtcaacttccacatgtttgacgtgggtggccagcgc
gacgaacgccgcaagtggatccagtgcttcaacgatgtgactgccatcatcttcgtggtg
gccagcagcagctacaacatggtcatccgggaggacaaccagaccaaccgcctgcaggag
gctctgaacctcttcaagagcatctggaacaacagatggctgcgcaccatctctgtgatt
ctgttcctcaacaagcaagatctgctcgctgagaaagtccttgctgggaaatcgaagatt
gaggactactttccagaatttgctcgctacactactcctgaggatgctactcccgagccc
ggagaggacccacgcgtgacccgggccaagtacttcattcgagatgagtttctgaggatc
agcactgccagtggagatgggcgtcactactgctaccctcatttcacctgcgctgtggac
actgagaacatccgccgtgtgttcaacgactgccgtgacatcattcagcgcatgcacctt
cgtcagtatgagctgctctaa

KEGG   Pongo abelii (Sumatran orangutan): 103888841
Entry
103888841         CDS       T01416                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05012  Parkinson disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
pon05142  Chagas disease
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103888841
   04020 Calcium signaling pathway
    103888841
   04072 Phospholipase D signaling pathway
    103888841
   04024 cAMP signaling pathway
    103888841
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103888841
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103888841
  09152 Endocrine system
   04911 Insulin secretion
    103888841
   04922 Glucagon signaling pathway
    103888841
   04923 Regulation of lipolysis in adipocytes
    103888841
   04912 GnRH signaling pathway
    103888841
   04913 Ovarian steroidogenesis
    103888841
   04915 Estrogen signaling pathway
    103888841
   04921 Oxytocin signaling pathway
    103888841
   04926 Relaxin signaling pathway
    103888841
   04935 Growth hormone synthesis, secretion and action
    103888841
   04918 Thyroid hormone synthesis
    103888841
   04928 Parathyroid hormone synthesis, secretion and action
    103888841
   04916 Melanogenesis
    103888841
   04924 Renin secretion
    103888841
   04925 Aldosterone synthesis and secretion
    103888841
   04927 Cortisol synthesis and secretion
    103888841
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103888841
   04270 Vascular smooth muscle contraction
    103888841
  09154 Digestive system
   04970 Salivary secretion
    103888841
   04971 Gastric acid secretion
    103888841
   04972 Pancreatic secretion
    103888841
   04976 Bile secretion
    103888841
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103888841
   04961 Endocrine and other factor-regulated calcium reabsorption
    103888841
  09156 Nervous system
   04724 Glutamatergic synapse
    103888841
   04728 Dopaminergic synapse
    103888841
   04726 Serotonergic synapse
    103888841
   04730 Long-term depression
    103888841
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103888841
  09159 Environmental adaptation
   04713 Circadian entrainment
    103888841
   04714 Thermogenesis
    103888841
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103888841
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103888841
  09165 Substance dependence
   05030 Cocaine addiction
    103888841
   05031 Amphetamine addiction
    103888841
   05032 Morphine addiction
    103888841
   05034 Alcoholism
    103888841
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103888841
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103888841
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103888841
   05165 Human papillomavirus infection
    103888841
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103888841
   05142 Chagas disease
    103888841
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103888841
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    103888841
   04031 GTP-binding proteins [BR:pon04031]
    103888841
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103888841
  Exosomal proteins of other body fluids (saliva and urine)
   103888841
  Exosomal proteins of colorectal cancer cells
   103888841
  Exosomal proteins of bladder cancer cells
   103888841
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    103888841
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 103888841
NCBI-ProteinID: XP_009232044
UniProt: A0A2J8TXG5
LinkDB
Position
20
AA seq 245 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSSAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIE
SETDFETEPETAPTTEPETEPEDDRGPVVPKHSIFGQSLTQRLHALKLRSPDASPSRAPP
STQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPI
PIRRH
NT seq 738 nt   +upstreamnt  +downstreamnt
atggatcggaggtcccgggctcagcagtggcgccgagctcgccataattacaacgacctg
tgcccgcccataggccgccgggcagccaccgcgctcctctggctctcctgctccatcgca
ctcctccgcgcccttgccacctccaacgcccgtgcccagcagcgcgcggctgcccaacag
cgccggagcttccttaacgcccaccaccgctccagcgcccaggtattccctgagtccccc
gaatcggaatctgaccacgagcacgaggaggcagaccttgagctgtccctccccgagtgc
ctagagtacgaggaagagttcgactacgagaccgagagcgagaccgagtccgaaatcgag
tccgagaccgacttcgagaccgagcctgagaccgcccccaccactgagcccgagaccgag
cctgaagacgatcgcggcccggtggtgcccaagcactccatcttcggccagtccctcacc
cagcgtctgcacgctctcaagttgcgaagccccgacgcctcccctagtcgcgcgccgccc
agcactcaggagccccagagccccagggaaggggaggagctcaagcccgaggacaaagat
ccaagggaccccgaagagtctaaggagcccaaggaggagaagcagcggcgtcgctgcaag
ccgaagaagcccacccgccgtgacgcgtccccggagtccccttccaaaaagggacccatc
cccatccggcgtcactaa

DBGET integrated database retrieval system