KEGG   Pongo abelii (Sumatran orangutan): 100442989
Entry
100442989         CDS       T01416                                 

Gene name
PLPP2
Definition
(RefSeq) phospholipid phosphatase 2 isoform X1
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00600  Sphingolipid metabolism
pon01100  Metabolic pathways
pon04072  Phospholipase D signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04975  Fat digestion and absorption
pon05231  Choline metabolism in cancer
Module
pon_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100442989 (PLPP2)
   00564 Glycerophospholipid metabolism
    100442989 (PLPP2)
   00565 Ether lipid metabolism
    100442989 (PLPP2)
   00600 Sphingolipid metabolism
    100442989 (PLPP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100442989 (PLPP2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100442989 (PLPP2)
  09154 Digestive system
   04975 Fat digestion and absorption
    100442989 (PLPP2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100442989 (PLPP2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     100442989 (PLPP2)
SSDB
Motif
Pfam: PAP2 PAP2_C
Other DBs
NCBI-GeneID: 100442989
NCBI-ProteinID: XP_024094084
Ensembl: ENSPPYG00000009267
LinkDB
Position
19
AA seq 242 aa
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV
TTTATIVLVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMI
GRLRPNFLAVCDPDWSRINCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLA
LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTV
SF
NT seq 729 nt   +upstreamnt  +downstreamnt
atgcagcggaggtgggtcttcgtgctgctcgacgtgctgtgcttactggtcgcctccctg
ccctttgctatcctgacgctggtgaacgccccgtacaagcgaggattttactgtggggat
gactccatccggtacccctaccgtccagataccatcacccacgggctcatggctggggtc
actacgacggccaccatcgtccttgtctcggccggggaagcctacctggtgtacacagac
cggctctattctcgctctgacttcaacaactatgtggctgctgtatacaaggtgctgggg
accttcctgttcggggctgctgtgagccagtctctgacagacctggccaagtacatgatt
gggcgtctgaggcccaacttcctagccgtctgcgaccccgactggagccggatcaactgc
tcggtctatgtgcagctggagaaagtgtgcaggggaaaccctgccgacgtcaccgaggcc
aggttgtctttctactcgggacactcttcctttgggatgtactgcatggtgttcttggcg
ctgtatgtgcaggcacggctctgttggaagtgggcacggctgctgcgacccacagtccag
ttcttcctggtggcctttgccctctacgtgggctacacccgcgtgtctgattacaaacac
cactggagcgatgtccttgttggcctcctgcagggggcactggtggctgccctcactgtg
agcttctaa

KEGG   Pongo abelii (Sumatran orangutan): 100448168
Entry
100448168         CDS       T01416                                 

Gene name
PLPP1
Definition
(RefSeq) phospholipid phosphatase 1 isoform X1
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00600  Sphingolipid metabolism
pon01100  Metabolic pathways
pon04072  Phospholipase D signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04975  Fat digestion and absorption
pon05231  Choline metabolism in cancer
Module
pon_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100448168 (PLPP1)
   00564 Glycerophospholipid metabolism
    100448168 (PLPP1)
   00565 Ether lipid metabolism
    100448168 (PLPP1)
   00600 Sphingolipid metabolism
    100448168 (PLPP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100448168 (PLPP1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100448168 (PLPP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    100448168 (PLPP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100448168 (PLPP1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     100448168 (PLPP1)
SSDB
Motif
Pfam: PAP2 PAP2_C MerC COX4 TPPK_C
Other DBs
NCBI-GeneID: 100448168
NCBI-ProteinID: XP_024103410
LinkDB
Position
5
AA seq 285 aa
MFDKTRLPYVALDVLCVLLASMPMAVLKLGQIYPFQRGFFCKDNSINYPYHDSTVTSTVL
ILVGVGLPISSIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIA
KYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAEKVKEGRLSFYSGHSSFSMYCM
LFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVA
ILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYRSNHQP
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtttgacaagacgcggctgccgtacgtggccctcgatgtgctctgcgtgttgctggct
tccatgcctatggctgttctaaaattgggccaaatatatccatttcagagaggctttttc
tgtaaagacaacagcatcaactatccgtaccatgacagtaccgtcacatccactgtcctc
atcctagtgggggttggcttgcccatttcctctattattcttggagaaaccctgtctgtt
tactgtaaccttttgcactcaaattcctttatcaggaataactacatagccactatttac
aaagccattggaacctttttatttggtgcagctgctagtcagtccctgactgacattgcc
aaatattcaataggcagactgcggcctcacttcttggatgtttgtgatccagattggtca
aaaatcaactgcagtgatggttacattgaatactacatatgtcgagggaatgcagaaaaa
gttaaggaaggcaggttgtccttctattcaggccactcttcgttctccatgtactgcatg
ctgtttgtggcactttatcttcaagccaggatgaagggagactgggcaagactcttacgc
cccacactgcaatttggtcttgttgccgtatccatttatgtgggcctttctcgagtttct
gattacaaacaccactggagtgatgtgttgactggactcattcagggagctctggttgca
atattagttgctgtatatgtatcagatttcttcaaagaaagaacttcttttaaagaaaga
aaagaggaggactctcatacaactctgcatgaaacaccaacaacagggaatcactatcgg
agcaatcaccagccttga

KEGG   Pongo abelii (Sumatran orangutan): 100455097
Entry
100455097         CDS       T01416                                 

Gene name
PLPP3
Definition
(RefSeq) phospholipid phosphatase 3
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00600  Sphingolipid metabolism
pon01100  Metabolic pathways
pon04072  Phospholipase D signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04975  Fat digestion and absorption
pon05231  Choline metabolism in cancer
Module
pon_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100455097 (PLPP3)
   00564 Glycerophospholipid metabolism
    100455097 (PLPP3)
   00565 Ether lipid metabolism
    100455097 (PLPP3)
   00600 Sphingolipid metabolism
    100455097 (PLPP3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100455097 (PLPP3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100455097 (PLPP3)
  09154 Digestive system
   04975 Fat digestion and absorption
    100455097 (PLPP3)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100455097 (PLPP3)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     100455097 (PLPP3)
SSDB
Motif
Pfam: PAP2 PAP2_C PAP2_3 YhhN Herpes_LMP1
Other DBs
NCBI-GeneID: 100455097
NCBI-ProteinID: XP_002810820
Ensembl: ENSPPYG00000001304
LinkDB
Position
1
AA seq 311 aa
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKAKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMV
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcaaaactacaagtacgacaaagcgatcgtcccggagagcaagaacggcggcagcccg
gcgctcaacaacaatccgaggagaagcggcagtaagcgggtgctgctcatctgcctcgac
ctcttctgcctcttcatggcgggcctccccttcctcatcatcgagacaagcaccatcaag
ccttaccaccgagggttttactgcaatgatgagagcatcaagtacccactgaaaactggt
gagacaataaatgacgctgtgctctgcgctgtggggatcgtcattgccatcctcgcgatc
atcacgggggaattctaccggatctattacctgaagaagtcgcggtcgacgattcagaac
ccctacgtggcagcactctataagcaagtaggctgcttcctctttggctgtgccatcagc
cagtctttcacagacattgccaaagtgtctatagggcgcctgcgtcctcacttcttgagt
gtctgcaaccctgatttcagccagatcaactgctctgaaggctacattcagaactacaga
tgcagaggtgatgacagcaaagtccaggaagccaggaagtccttcttctctggccatgcc
tccttctccatgtacactatgctgtatttggtgctatacctgcaggcccgcttcacttgg
cgaggagcccgcctgctccggcccctcctgcagttcaccttgatcatgatggccttctac
acgggactgtcccgcgtatcagaccacaagcaccatcccagtgatgtgctggcaggattt
gctcaaggagccctggtggcctgctgcatagttttcttcgtgtctgacctcttcaaggct
aagacgacgctctccctgcctgcccctgctatccggaaggaaatcctttcacctgtggac
attattgacaggaacaatcaccacaacatggtgtag

DBGET integrated database retrieval system