KEGG   Pongo abelii (Sumatran orangutan): 100443121
Entry
100443121         CDS       T01416                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03460  Fanconi anemia pathway
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100443121 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100443121 (POLK)
   05202 Transcriptional misregulation in cancer
    100443121 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100443121 (POLK)
   05212 Pancreatic cancer
    100443121 (POLK)
   05225 Hepatocellular carcinoma
    100443121 (POLK)
   05226 Gastric cancer
    100443121 (POLK)
   05214 Glioma
    100443121 (POLK)
   05216 Thyroid cancer
    100443121 (POLK)
   05220 Chronic myeloid leukemia
    100443121 (POLK)
   05217 Basal cell carcinoma
    100443121 (POLK)
   05218 Melanoma
    100443121 (POLK)
   05213 Endometrial cancer
    100443121 (POLK)
   05224 Breast cancer
    100443121 (POLK)
   05222 Small cell lung cancer
    100443121 (POLK)
   05223 Non-small cell lung cancer
    100443121 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100443121 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pon03400]
    100443121 (POLK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100443121 (POLK)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100443121 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone zf-C2H2_12
Other DBs
NCBI-GeneID: 100443121
NCBI-ProteinID: NP_001126479
Ensembl: ENSPPYG00000015562
UniProt: Q5R6T8
LinkDB
Position
5
AA seq 898 aa
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQSQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIKPPNFDKYRAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGNSVENDNPGKEVNK
LSERERSISPLLFEESPSDLQPPGDPFQVNFEEQNNPQILQNSVVFGTSAEEVVKEIRFR
IEQKTTLTASAGNNLIISFSLGDFNPVQDCRREPRRPQGIAPNTMLAKVCSDKNKPNGQY
QILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWH
YFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKQRLKG
RTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRLRLMGVRI
SSFPNEEDRKHQQRSIIGFLQAGNQALSATECILEKTDKDKFVKPLEMSHKKSFFDKKRS
ERKWSHQDTFKCEAVNKQSFQTSQPFQVLKKKMNENLEISENSDDCQIFTCPVCFRAQGC
ISLEALNKHVDECLDGPSISENFKMFSCSHVSATKVNKKENVPAASLYEKQDYEAHPKIK
EISSVDCVALVDTIDDSSKAESTDALSNKHSKEECSSLPSKSFNIEHCHQNSSCTVSLKN
EDIGSLSRQEYRQPYLCEVKTGQALVCPVCNVEQNTSDLTLFNVHVDVCLNKSFIQELRK
DKVNPVNQPKESSRSTGSSSGVQKAVTRTKRPGLMTKYSTSKKIKPNNPKHTLDIFFK
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggatagcacaaaggagaagtgtgacagttacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacaaaggggtccagattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaatcacaggttgacagatttgcaatggaattagaacagagccgaaatttgagc
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgctgtctacttcaaat
taccatgcaaggagatttggtgttcgtgcagccatgccaggatttattgctaagagactg
tgcccacaacttataataaagcccccaaactttgacaaataccgagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttagaagaaagacaaaattggcctgaggataaaagaagg
tatttcatcaaaatgggaaactctgtagaaaatgataatccaggaaaggaagttaataaa
ctgagtgagcgtgaacgatccatctctccactactttttgaagagagtccttctgatttg
cagcccccaggagatcctttccaagtgaactttgaagaacaaaacaatcctcaaatactc
caaaactcagttgtttttggaacatcagccgaggaagtggtaaaggaaattcgtttcaga
attgagcagaaaacaacactgacagccagtgcaggtaataacttgattattagtttttcc
ttgggagacttcaatcctgtccaagattgcaggagagaacccagacggccacaaggcatt
gccccaaatacaatgttagcaaaagtctgcagtgataagaataaaccaaatggacaatac
caaattcttcccaatagacaagctgtgatggacttcatcaaggatttacccattagaaag
gtttctggaataggaaaagttacagagaaaatgttaaaggcccttggaattattacatgt
acagaactttaccaacagagggcattgctttctctccttttctctgaaacatcttggcat
tatttccttcatatctccttgggtctaggttcaacacacctgacaagggatggagagagg
aaaagtatgagcgttgagaggacattcagtgagataaataaagcggaagaacaatacagc
ctatgtcaagaactttgcagtgagcttgctcaggatctacagaaacaaagacttaagggt
agaactgttaccattaagttgaagaatgtgaattttgaagtaaaaactcgtgcatctaca
gtttcatctgttgtttctactgcagaagaaatatttgccattgctaaggaattgctaaaa
acagaaattgatgctgattttccacatcccttgagattaagacttatgggtgttcggata
tctagttttcccaatgaagaagacaggaaacaccaacaaaggagcattattggcttttta
caggctggaaaccaagccctgtcagccactgagtgtatactagagaaaactgacaaagat
aagtttgtaaaacctctagaaatgtctcataagaagagtttctttgataaaaaacgatca
gaaaggaaatggagtcaccaagatacatttaaatgtgaagccgtgaataaacaaagtttc
cagacatcacaaccattccaagttttaaagaagaagatgaatgagaatttggaaatatca
gagaattcagatgactgtcagatatttacctgtcctgtttgctttagggcacaagggtgc
atcagtctggaagccttgaataaacatgtagatgaatgtcttgatggaccttcaatcagt
gaaaactttaaaatgttctcgtgttcacatgtttctgctaccaaagttaacaagaaagaa
aatgttcctgctgcttcactttatgagaagcaagattatgaagcccatccaaaaattaaa
gaaatatcttcagtagattgtgtagctttagtagatactatagatgactcatctaaagca
gaaagcacagatgctttaagtaataagcatagcaaggaagaatgttctagtctcccaagc
aagtcttttaatattgaacactgtcatcagaattcttcttgtactgtttcattgaaaaat
gaagatattggatcattaagtagacaagaataccgccagccttacttatgtgaagtgaaa
acaggccaagctctagtttgtcctgtttgtaacgtagaacaaaacacttcagatctaacc
ctgttcaatgtgcatgtggatgtttgcttaaataaaagttttatccaagaattaagaaag
gataaagttaacccagttaatcaacccaaagaaagctccagaagtactggtagctcaagt
ggagtacagaaggctgtaacaagaacaaaaaggccaggattgatgacaaagtactcaaca
tcaaagaaaataaaaccaaacaatcccaaacatacccttgatatattttttaagtaa

DBGET integrated database retrieval system