KEGG   Pongo abelii (Sumatran orangutan): 100443231Help
Entry
100443231         CDS       T01416                                 

Gene name
HESX1
Definition
(RefSeq) homeobox expressed in ES cells 1
  KO
K09354  homeobox protein expressed in ES cells 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100443231 (HESX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100443231 (HESX1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, XANF
    100443231 (HESX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 100443231
NCBI-ProteinID: XP_024100846
Ensembl: ENSPPYG00000013775
LinkDB All DBs
Position
3
AA seq 185 aa AA seqDB search
MSPSLQEGAQLGESKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCL
HVPNPPSGISFPSMVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQI
EVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFN
TNLLE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccagccttcaggaaggcgctcagcttggggaaagcaaaccctcaacttgctcc
ttttcaattgagagaatcttaggactggaccagaagaaagactgtgttccattaatgaaa
ccccacaggccctgggcagacacctgcagctcctcagggaaagatggtaacttatgtcta
catgtcccaaatcctcccagtgggatttcattccctagcatggtggatcacccaatgcca
gaagaaagagcttcgaaatatgaaaattacttttcagcctcagaaagactgtctttgaaa
agagagttgagttggtatagaggccgaagaccaagaactgcttttactcaaaaccagatc
gaagtgttagaaaatgtctttagagtaaactgctatcctggtatcgatattagagaagac
ttagctcaaaaattgaatctagaggaagacagaatccagatttggtttcaaaatcggcgt
gcaaaactgaaaaggtcccatagagaatcacagtttctaatggcgaaaaaaaatttcaac
acaaatctcctggaatag

DBGET integrated database retrieval system