KEGG   Pongo abelii (Sumatran orangutan): 100443243
Entry
100443243         CDS       T01416                                 

Gene name
EREG
Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100443243 (EREG)
   04012 ErbB signaling pathway
    100443243 (EREG)
   04151 PI3K-Akt signaling pathway
    100443243 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100443243 (EREG)
SSDB
Motif
Pfam: EGF BCCT CD34_antigen
Other DBs
NCBI-GeneID: 100443243
NCBI-ProteinID: XP_002814919
Ensembl: ENSPPYG00000014837
UniProt: A0A6D2Y5Q2 H2PDL6
LinkDB
Position
4
AA seq 169 aa
MTAGKRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaccgcggggaagaggatggagatgctctgtgccggcagggtccctgcgctgctgctc
tgcctgggttttcatcttctacaggcagtcctcagtacaactgtgattccatcatgtatc
ccaggagagtccagtgataactgcacagctttagttcagacagaagacaatccacgtgtg
gctcaagtgtcaataacaaagtgtagctctgacatgaatggctactgtttgcatggacag
tgcatctacctggtggacatgagtcaaaactactgcaggtgtgaagtgggttatactggt
gtccgatgtgaacacttctttttaaccgtccaccaacctttaagcaaagaatatgtggct
ttgaccgtgattcttattattttgtttcttatcacagtcgtcggttccacatattatttc
tgcagatggtacagaaatcgaaaaagtaaagaaccaaagaaggaatatgagagagttact
tcaggggatccagagttgccacaagtctga

DBGET integrated database retrieval system