KEGG   Pongo abelii (Sumatran orangutan): 100443298
Entry
100443298         CDS       T01416                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04510  Focal adhesion
pon04666  Fc gamma R-mediated phagocytosis
pon04722  Neurotrophin signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04935  Growth hormone synthesis, secretion and action
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100443298 (CRKL)
   04012 ErbB signaling pathway
    100443298 (CRKL)
   04015 Rap1 signaling pathway
    100443298 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100443298 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100443298 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100443298 (CRKL)
   04062 Chemokine signaling pathway
    100443298 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100443298 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    100443298 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100443298 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100443298 (CRKL)
   05206 MicroRNAs in cancer
    100443298 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100443298 (CRKL)
   05211 Renal cell carcinoma
    100443298 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100443298 (CRKL)
   05100 Bacterial invasion of epithelial cells
    100443298 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100443298 (CRKL)
   05163 Human cytomegalovirus infection
    100443298 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100443298 (CRKL)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100443298 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 100443298
NCBI-ProteinID: XP_002834682
UniProt: A0A2J8RZE4
LinkDB
Position
22
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctccgcctggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgat
tcttccacctgccctggggactatgtgctgtcggtgtccgagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggaatttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccaccctcatcgag
cccgcgcccaggtatccaagcccaccaatgggatctgtctcagcacccaacctgcctaca
gcagaagataacctggaatatgtacggactctgtatgattttcctgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcatacgctcaacctcagaccacaactcctctacctgcagtttcc
ggttctcctggggcagcaatcacccctttgccatccacacagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacatcgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaggtgaat
gggcgcaaagggcttttcccctttacgcacgtcaaaatctttgaccctcaaaacccagat
gaaaacgagtga

KEGG   Pongo abelii (Sumatran orangutan): 100452410
Entry
100452410         CDS       T01416                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04510  Focal adhesion
pon04666  Fc gamma R-mediated phagocytosis
pon04722  Neurotrophin signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04935  Growth hormone synthesis, secretion and action
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100452410 (CRK)
   04012 ErbB signaling pathway
    100452410 (CRK)
   04015 Rap1 signaling pathway
    100452410 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100452410 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100452410 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100452410 (CRK)
   04062 Chemokine signaling pathway
    100452410 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100452410 (CRK)
   04935 Growth hormone synthesis, secretion and action
    100452410 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100452410 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452410 (CRK)
   05206 MicroRNAs in cancer
    100452410 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100452410 (CRK)
   05211 Renal cell carcinoma
    100452410 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100452410 (CRK)
   05100 Bacterial invasion of epithelial cells
    100452410 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100452410 (CRK)
   05163 Human cytomegalovirus infection
    100452410 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100452410 (CRK)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100452410 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 100452410
NCBI-ProteinID: XP_002826851
Ensembl: ENSPPYG00000007770
UniProt: A0A2J8SNR0
LinkDB
Position
17
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggttgagtcgg
caggaggcggtggcgctgctgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctcagagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgagccctc
tttgactttaatgggaatgatgaggaagatcttccctttaagaaaggagacatcttgaga
atccgggacaagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagagaggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatatatgcc
agggttatccagaagcgagtccccaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system