KEGG   Pongo abelii (Sumatran orangutan): 100443362
Entry
100443362         CDS       T01416                                 

Gene name
THBD
Definition
(RefSeq) thrombomodulin
  KO
K03907  thrombomodulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04610  Complement and coagulation cascades
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100443362 (THBD)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100443362 (THBD)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100443362 (THBD)
CD molecules [BR:pon04090]
 Proteins
  100443362 (THBD)
Proteoglycans [BR:pon00535]
 Cell surface proteoglycans
  Others
   100443362 (THBD)
Lectins [BR:pon04091]
 C-Type lectins
  Group 14: Thrombomodulin
   100443362 (THBD)
SSDB
Motif
Pfam: FXa_inhibition Tme5_EGF_like cEGF EGF_CA EGF Lectin_C
Other DBs
NCBI-GeneID: 100443362
NCBI-ProteinID: XP_024094817
LinkDB
Position
20
AA seq 631 aa
MSEAASQGLRAAARSVWAGTDRSGCRHRRPAPLCSSTAPSQCPRFPWRLHAARLGNMLGV
LVLGVLALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLDASQICDGLRGHLMTVRS
SVAADVISLLLSGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNRTSYSRWAR
LDLSGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGA
AAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLELTCAAPPGAVQGHWAREAPGAWD
CGVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTAPATQSCNDLCEHFCVPNPDQPG
SYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVE
PVDPCFGSNCEYQCQPLNQTSYLCVCAEGFAPVPHEPHRCQMFCNQTACPAVCDSNTQAN
CECPEGYILDEGFICTDIDECENGGFCSGVCRNLPGTFECICGPDSALTRHIGTDCDSGK
VDGGDRGSGERPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLRKKQG
AARAKMEYKCAAPSKEVVLQHVRTERTPQRL
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgtcagaggctgcctcgcaggggctgcgcgcagcggcaagaagtgtctgggctgggacg
gacaggagcggctgtcgccatcggcgtcctgcgcccctttgctccagcacggccccgtcg
cagtgcccgcgctttccctggcgcctgcacgcggcgcgcctgggtaacatgcttggggtc
ctggtccttggcgtgctggccctggccggcctggggttccccgcacccgcagagccgcag
ccgggtggcagccagtgcgtcgagcacgactgcttcgcgctctacccgggccccgcgacc
ttcctcgatgccagtcagatctgcgacggactgcggggccacctaatgacagtgcgctcc
tcagtggctgccgatgtcatttccttgctactgagcggcgacggcggcgttggccgccgg
cgcctctggatcggcctgcagctgccacccggctgcggcgaccccaagcgcctcgggccc
ctgcgcggcttccagtgggttacgggagacaaccgcaccagctatagcaggtgggcgcgg
ctcgacctcagtggggctcccctctgcggcccgttgtgcgtcgctgtctccgctgctgag
gccactgtgcccagcgagccgatctgggaggagcagcagtgcgaagtgaaggccgatggc
ttcctctgcgagttccacttcccagccacctgcaggccactggctgtggagcccggcgct
gcggctgccgccgtctcgatcacctacggcaccccgtttgcggcccgcggagcggacttc
caggcgctgccggtgggcagctccgccgcggtggcgcccctaggcttagagctaacgtgc
gccgcgccgcccggagcggtccaggggcactgggctagggaggcgccgggcgcttgggac
tgcggcgtggagaacggcggctgcgagcacgcgtgcaatgcgatccctggggctccccgc
tgccagtgcccagccggcgccgccctgcaggcagacgggcgttcctgcaccgcacccgcg
acgcagtcctgcaacgacctctgcgagcacttctgcgttcccaaccccgaccagccgggc
tcctactcgtgcatgtgcgagaccggctaccggctggcggccgaccaacaccggtgcgag
gacgtggatgactgcatactggagcccagtccgtgtccgcagcgctgtgtcaacacacag
ggtggtttcgagtgccactgctaccctaactacgacctggtggacggcgagtgtgtggag
cccgtggacccgtgcttcggaagcaactgcgagtaccagtgccagcccctgaaccaaact
agctacctctgcgtctgcgccgagggattcgcgcccgttccccacgagccgcacaggtgc
cagatgttttgcaaccagactgcctgtccagccgtctgcgactccaacacccaggctaac
tgtgagtgccctgaaggctacatcctggacgaaggtttcatctgcacagacatcgacgag
tgcgaaaacggcggcttctgctccggggtgtgccgcaacctccccggtaccttcgagtgc
atctgcgggcccgactcggcccttacccgccacattggcaccgactgtgactccggcaag
gtggacggtggcgaccgcggctctggcgagcgcccccccagcccgacgcccggctccacc
ttgactcccccggccgtggggctcgtgcattcgggcttgctcataggcatctccatcgcg
agcctgtgcctggtggtggcgcttttggcgctcctctgccacctgcgcaagaagcaggga
gccgccagggccaagatggagtacaagtgcgcggcgccttccaaggaggtagtgctgcag
cacgtgcggaccgagcggacgccgcagagactctga

DBGET integrated database retrieval system