KEGG   Pongo abelii (Sumatran orangutan): 100443502
Entry
100443502         CDS       T01416                                 

Gene name
TNXB
Definition
(RefSeq) LOW QUALITY PROTEIN: tenascin-X
  KO
K06252  tenascin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05165  Human papillomavirus infection
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100443502 (TNXB)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100443502 (TNXB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100443502 (TNXB)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100443502 (TNXB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100443502 (TNXB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100443502 (TNXB)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100443502 (TNXB)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin DUF2369 DUF4959 hEGF
Other DBs
NCBI-GeneID: 100443502
NCBI-ProteinID: XP_024104015
Ensembl: ENSPPYG00000016478
LinkDB
Position
6
AA seq 4244 aa
MMPAQYALTSSLVLLVLLSTARAGPFPSRSNVTLPAPRPPPQPGGRTVGAGVGSPSSQLY
EHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVPASEVQALRVRLEILEELVKGLKEQ
CTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
GPDCSQRSCPRGCSQRGRCEDGRCVCDPGYTGDDCGMKSCPRGCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQRGRCEDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
CWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
CVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGRCED
GVCVCDADHSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC
QDGVCICWEGYVGEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRG
RCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYE
IQFIPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMI
DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPSGLLGTTDEPPPSGPSTTQGAQAPLLQQRP
QELGELRVLGRDETGRLRVVWTAQPDTFAHFQLRLRVPEGPGAHEEVLPGDVRRALVPPP
PPGTTYELSLRGVPPGGKPSDPIIYQGVMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHG
PLVAEAKILPQSDPSPGTPPRLGNLWVTDPTPDSLHLSWTVPEGQFDTFMVQYRDRDGRP
QVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPHPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLD
PDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELGTEAPESPEEPLLGELTV
TGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHKGQRVGPVSAMGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWMVPEGQ
FDSFMVQYKDKDGQPQVVPVAADQREVTVYNLEPERKYKMNMYGLHDGQRMGPLSVVIMT
APLPTAPATEASKPPLEPRLGELTVTDVTPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGEL
WVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTVTPLDAGRKYRFL
LYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPLKPRLGEELQVTSVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHGSKRVGPISAVA
VTAGREEMETETTAPTSPAPEPHLGELTVEEATPHTLHLSWMVTEGEFDSFEIQYTDRDG
QLQMVRTGGDRNDITLSGLESDHRYLVTLYGFRDGKHVGPVRVEALTVPEEEEPSEPPTA
TTEPPIKPHLGELTVTDATPDSLSLSWTVPEGQFGHFLVQYRNGDGQPKAVRVPGHEDGV
TVSGLEPDHKYKMNLYGFHGGQRVGPVSVIGVTAAEEETPSPTEPSMEAPEPPEEPLLGE
LTVTGSSPDSLSLSWTIPQGRFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPGRKYK
MHLYGLHEGQRMGPVSAVGVTAPEEESPDAALVKPRLGEMTVTDVTSDSLSLSWTVPEGQ
FDHFLVQYKNVDGQPKAVRVPGYEDGVSISGLEPDHKYKMNLYGFHGGQRVGPVSAVGLT
APGKDEEMAPDSTEPPTPEPPIKPRLEELTVTDVTPDSLSLSWKVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDHKYKMNLYGFHGGQRVGPVSVIGVTAAEEETPRPTE
PSTEAPEPPEEPLLGELTVTESSPDSLSLSWTVPQGHFDSFTVQYKDRNGQPQVVRVGGE
ESEVTVGGLEPGRKYKMHLYGLHEGQRVGPVSTVGLTAPREDVDKTPSPTEPGTEAPEPP
AEPLLGELTVTGSSPDSLSLSWTIPQGRFDSFTVQYKDRDGRPQAVRVGGQESEVTVGGL
EPGRKYKMHLYGLHEGQRLGPVSAVGITAPEDEAETTQAVPTTTPESPIKPRLGELTVTD
ATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGITVSGLEPDHKYKMNLYG
FHSGQRVGPVSVIGVTAAEEETPSPTEPSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTI
PQGRFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPRRKYKMHLYGLHEGRRVGPVST
VGVTDDEAETTQAVPTTTPEPPIKPRLGELTVTDATPDSLSLTWMVPEGQFDHFLVQYRN
GDGQPKAVRVPGHEDGITISGLEPDQKYKMNLYGFHGGQRMGPVSVIGVTAAEEETPAPT
EPSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGG
EESEVTVGGLEQGRKYKMHLYGLHEGQRVGPVSAVGVTAPEDEAETTQAVPTTTPEPPIK
PHLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTVSGLEP
DHKYKMNLYGFHGGQRVGPVSVIGVTEEENPSPTEPSTEAPEPPEEPLLGELTVTGSSPD
SLSLSWTVPQGRFDFFTVQYKDRNGQPQAVRVGGEESEVTVRGLEPGRKYKMHLYGLHEG
QRMGPVSTVGVTAPLPTPPPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQ
GQPQAVPVSGDLRAVTVSGLDPARKYKFLLFGLQNGKRHGPVPVEARTAPDTKPSPHLGE
LTVTDATPDSVGLSWTVPEGEFDSFVLQYKDKDGQLQVVPVAANQREVTVQGLEPSRKYR
FLLYGLSGRKRLGPISAESTTAPLEKEPPPRLGELTVAEETSSSLRLSWTVAQGPFDSFV
VQYRDTDGQPRAVPVAADQRTVTIEDLEPGKKYKFLLYGLLGGKRLGPVSALGMTAPEED
TPAPELXPEAPEPPEEPRLGVLTVTDTTPDSLRLSWSVAQGPFDSFVVQYEDTNGQPQAL
LVDGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGLAPAGQTSAESRPRLSQ
LSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVL
RDLRPGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIREASAKVNWMXPP
SRADSFKVSYQLADGGEPQSIQVDGRARTQKLQGXIPGARYEVTVVSVRGFEESEPLTGF
LTTVPDGPHAVRALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPPLQAEAPGSAVDYPL
HDLVLHTNYTATVRGLRGPXLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPQFRP
TGYLLSFDTPGGQTQEILLPGGITSHQLLGLFPSTPYNARLQAMWGQSLLPPVSTSFTTG
GLWIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQT
DFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFRVDS
AAEYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNNLLISCAVSYRGXWWYRNCHYANL
NGLYGSTVDHQGVSWYYWKGFEFSVPFTEMKLRPRNFRSPAGGG
NT seq 12735 nt   +upstreamnt  +downstreamnt
atgatgccagcccagtatgctctaacctccagcctggttctcctggtgctgctgagcaca
gccagagcaggccccttcccttcacggtccaatgtgacactgccagccccccggccccct
ccccagccagggggccgcacagtgggggccggagtgggaagcccctcttctcagctttac
gagcacacagtggaaggaggggagaagcaggtggtattcacccaccgcattaacctgccc
ccttccactggctgtggctgtcccccaggcactgagcccccagtccctgcttcagaggtg
caggccctgagagtccggctagagatcctggaggagttggtgaaggggctcaaggaacag
tgcactgggggatgttgtcctgcctctgcccaagctggcacaggtcagacagatgtgcgg
accctctgcagtctccatggtgtgtttgatctgagccgctgcacctgttcctgtgagcca
ggctggggtgggcccacctgctcagacccaacagatgctgagatccctccctcctcccca
ccctcagcctcggggtcctgcccagatgactgcaatgatcagggtcgctgtgtccgtggt
cgttgcgtgtgctttcccggctacactggccccagctgtggctggccatcctgtcccggg
gactgccaaggccgtgggcgctgcgtgcagggcgtgtgcgtgtgcagggcaggcttctca
ggcccagactgcagccagcgctcctgccctcggggttgcagccagaggggacgctgtgag
gatgggcgctgcgtgtgtgacccaggctacactggtgacgactgtggcatgaagagctgc
cctcgcggttgcagtcagagggggcgctgtgagaatgggcgctgcgtgtgcaacccgggc
tacactggcgaggactgtggggtgaggagctgccctcggggctgcagccagcggggacgc
tgcgaggacgggcgctgcgtgtgtgaccccggctacactggcgaggactgtggtacgcgg
agctgcccctgggactgtggggagggcgggcgctgcgtggacggccgctgcgtgtgctgg
cccgggtacacaggcgaggactgcagcacgcggacatgtccgagggactgccggggccgc
gggcgctgcgaggacggcgaatgcatttgcgacacgggctacagcggggacgattgcggc
gtgcgcagctgccctggtgactgcaaccaaaggggccgctgcgaggacggccgctgcgtg
tgctggccggggtacactggaaccgattgcggctcgcgcgcctgcccacgcgactgtaga
ggtcgcgggcgctgcgagaacggcgtgtgtgtttgcaacgcgggctacagcggcgaggac
tgcggtgtgcgcagctgtcctggggactgtcgtggccggggccgctgtgagagtggccgc
tgcgtgtgttggccggggtacacaggccgggactgcggcacgcgcgcctgtcctggcgac
tgtcgcgggcgcgggcgctgcgtggatggccgctgcgtgtgcaacccgggcttcaccggt
gaggactgtgggagccgtcgctgtcccggggactgccgtgggcacggccgttgcgaggat
ggcgtgtgcgtgtgtgacgcagaccactcaggggaggactgcagcacgcgcagctgcccc
gggggctgccgaggccgcggccagtgcctagatgggcggtgtgtgtgcgaggacggctac
tctggcgaggattgcggtgtgaggcagtgcccgaatgactgcagccagcacggcgtgtgc
caggacggtgtgtgcatctgttgggaaggctacgtgggcgaggactgtagcatccgcacc
tgcccctccaactgccatgggaggggccgctgtgaggaagggcgctgcctgtgcgaccca
ggctacaccggccccacctgtgccacccgcatgtgcccggctgactgccggggacgtggg
cgctgtgtgcagggagtgtgcctgtgccacgtgggctatggcggtgaggactgcgggcag
gaagagcctccagccagcgcctgccctggaggctgcggaccccgggaactgtgccgggca
ggccagtgtgtgtgtgtagagggcttccgaggccctgactgtgccatccagacatgccca
ggggactgccgtggccgaggagagtgtcacgatggcagctgtgtctgcaaagatgggtat
gctggcgaagactgcggggaagaggtgccaaccattgagggcatgaggatgcatctcttg
gaggagacaacagttcggacagagtggaccccggctcctggccctgtggatgcctatgaa
attcagttcatccccacgacagagggggcgagccccccattcacagcacgggttccaagc
tctgcctcagcctatgaccagagaggactggcccctggacaggagtaccaggtcactgtc
cgagcccttcgagggaccagctggggccttcctgcctccaagaccatcaccaccatgatc
gatgggccccaggacctccgagtggtggctgtgacgccaacaacactggagcttggctgg
ctgcgtccccaggccgaggtggaccgatttgtggtgtcctacgtcagtgccggcaaccag
agggtgcggctggaagtgccccctgaagcagatgggacgctgctgactgacctgatgcca
ggcgtagaatatgtggtgactgtcacagcagagcggggccgggcagtcagctacccagct
tctgtcagggccaacacagggtcctcaccctcgggcctcttggggactaccgatgagcct
cctccctcaggcccctcgacgacgcaaggggcccaggctcctctcctgcagcagcgcccc
caggagctgggagagttgagggtgctgggcagagatgagacagggcgcctccgtgtggtc
tggaccgcccagcccgacacctttgcccacttccaactgcgcctgcgggtgcccgagggg
ccgggggcacatgaggaagtgctgccaggggacgtccgccgggctctggtgcctccaccc
cctcctggaaccacgtatgagctgtcacttcgtggggtccctcctgggggcaagccctct
gaccccatcatctaccaaggcgttatggacaaggatgaggagaagcctgggaagtcctca
ggcccaccacgcctgggtgagctgacagtgacagacaggacctccgactccttgctcctg
cgctggacagtccccgagggcgagtttgactccttcgtgatccagtacaaggacagggac
gggcagccccaggtggtgcccgtggagggaccccagcgctcggctgtcatcacctccctg
gatcctggccgcaagtacaaatttgtcctgtacgggttcgttggcaagaagaggcatggt
ccactggtggctgaagccaagatcttgcctcagagtgacccaagtccagggactccaccc
cgcctgggaaatctgtgggtgacagaccctaccccagattcactgcacctctcctggact
gtccctgagggccagttcgacaccttcatggtccagtacagggacagggatggacggccc
caggtggtacctgtggaagggcccgagcgttcatttgttgtctcctcactggaccctgac
cacaagtacagattcactctgtttggaatcgcgaacaagaagcggtatggccccctcacg
gccgatggcaccactgctccagagaggaaagaggagcccccccaccctgagttcctggag
cagcccctcctgggggaactgacagtgaccggtgtgaccccagactccttgcgcctctca
tggacggtagcccagggccccttcgactcgttcatggtccagtacaaggatgcacagggg
cagccccaggcagtgcctgttgcgggggatgagaatgaggttaccgtccccggcctggat
cccgaccggaagtataagatgaacctctacgggcttcgtggcaggcagcgtgtggggccc
gagtctgtggtggccaagactgctcctcaggaggatgtggacgagacccccagccccaca
gaactgggcacggaggccccagagtcccccgaggagccactcctgggggagctgacagtg
acaggatcctcccctgattcgctgagcctctcctggaccgtcccccagggccgcttcgac
tccttcaccgtgcagtacaaggacagggacgggcggccccaggcggtgcgtgttgggggc
aaggagagtgaggtcaccgtggggggcctagagcccgggcacaagtacaagatgcacctg
tacggcctccacaaggggcagcgcgtgggcccggtgtccgccatgggcgtgacagcccca
caacaagaagagacccctccagccaccgagtccccgctggagccacgcctaggagagctg
acagtgacagacgtgacccccaactctgtgggcctctcctggatggtccccgagggccag
tttgactccttcatggtccagtacaaggacaaggacgggcagccccaggtggtgccggtg
gctgcagaccagcgagaggtcacggtctacaacctggagcctgagagaaaatacaagatg
aacatgtatggactacatgatgggcaacgcatgggccccctgtctgtggtcatcatgacg
gctcccctcccaacagccccagccacagaggcctccaagcctcccctggagccacgccta
ggggagctgacagtgacggatgtaacccctgactctgtgggcctctcgtggacagtccct
gagggtgaattcgactcctttgtggttcagtacaaggacagggacgggcagccccaggtg
gtgcccgtggctgcagaccagcgggaggtcaccatccctgacctggaaccctcccgcaag
tacaagttcctgctctttgggatccaggatgggaaacgacgcagcccagtctctgtggag
gcaaagacggttgcccgaggtgacgccagcccaggggccccaccccgccttggggagctg
tgggtgacagaccccaccccagactcactgcgcctctcctggacggttcctgagggccag
ttcgactcttttgtggtccagttcaaggacaaagatgggccccaggtggtgcccgtggag
ggccatgagcgctctgtcaccgtcacccctctggacgccggccgcaagtacagattcctc
ctctatggcctcctgggcaaaaagcgccatggccccctcactgccgacggcaccacggag
gcccggagtgctatggacgatactggaacaaagcgtcccctaaaaccccgtctgggggag
gagctgcaggtgaccagcgtgacccagaactccgtgggcctctcctggacagtccctgag
ggccagtttgactcctttgtggtccagtacaaggacagggacgggcagccccaggtggtg
cccgtggagggcagcctcagggaggtcagcgtgccgggcctggaccccgcccacaggtac
aagctgctgctctacgggctgcacggcagcaagcgtgtgggccccatctcggccgtcgcc
gtaactgccggcagggaagaaatggaaactgagaccacggccccgacctctccagcgcct
gagccccaccttggggagttgacagtggaggaggccacgccacataccctgcatctctcc
tggatggtgactgagggagaatttgactccttcgaaatccagtacacagatagagacggg
caactccaaatggtccgtacaggaggcgaccggaatgacatcaccctctctggcctggaa
tccgaccacagatacctggtgacactgtatggtttccgtgatgggaagcatgtgggtcct
gtccgtgtcgaggccctgacagtcccggaggaggaggagccttcagaacctcccaccgca
accaccgagccccccatcaaacctcacctgggggagctgaccgtgacagatgccacccct
gactccctcagcctgtcctggacggttcccgagggccagtttggccacttcctggtccag
tacaggaatggggacgggcagcccaaggcggtgcgggtgccagggcacgaggatggggtc
accgtctccggcctggagccagaccacaagtacaagatgaacctgtacggcttccacggt
ggccagcgcgtgggtcccgtgtctgtcatcggggtgacggctgcagaggaagagaccccc
agccccacagaacccagcatggaggccccagagccccctgaggagccgctcctgggggag
ctgacagtgacaggatcctcccctgactcgctgagcctctcctggaccatcccccagggc
cgcttcgactccttcaccgtgcagtacaaggacagggacgggcggccccaggtggtgcgt
gtcaggggcgaggagagcgaggtcactgtggggggcctggagcccgggcgcaaatacaag
atgcacctgtacggcctccacgaggggcagcgcatgggcccagtgtctgctgtgggcgtc
acggcccctgaagaggagtcccctgatgctgcccttgtgaagccgcgcctaggggagatg
acagtgacagatgtcacctccgactccctcagcctctcctggacagtccccgagggccaa
tttgaccatttcttggtccagtacaagaatgtggatgggcagcccaaggcggtgcgagtg
ccgggatatgaggacggggtctccatctcgggcctggagccagaccacaagtacaagatg
aacctgtacggcttccacggtggccagcgtgtgggccccgtgtctgctgttggtttaact
gccccaggaaaggatgaagaaatggccccagactcgacagaacctcccacccctgaaccc
cccatcaagcctcgcctggaggagctgaccgtgacagatgtgacccctgactccctcagc
ctgtcctggaaggttcccgagggccagtttgaccacttcctggtccagtacaagaatggt
gatgggcagcccaaggcaacacgggtgccaggacatgaggacagggtcaccatctccggc
ctggagccagaccacaagtacaagatgaacctgtatggcttccacggtggccagcgcgtg
ggtcccgtgtctgtcatcggggtgacggctgcagaggaagagacccccaggcccacagaa
cccagcactgaggccccggagccccctgaggagccgctcctgggggagctgacagtgaca
gaatcctcccctgactcgctgagcctctcctggaccgtcccccagggccactttgactcc
ttcaccgtgcagtacaaggacaggaatgggcagccccaggtggtgcgtgttgggggcgag
gagagcgaggtcaccgtggggggcctggagcctgggcgcaaatacaagatgcacctgtac
ggcctccacgaggggcagcgcgtgggcccagtgtccaccgtgggcctgactgccccacga
gaggatgtggacaagacccccagccctacagaaccaggcacagaggccccagagcccccc
gcggagccactcctgggggagctgacagtgacaggatcctcccctgactcgctgagcctc
tcctggaccatcccccagggccgcttcgactccttcactgtgcagtacaaggacagggac
gggcggccccaggcggtgcgtgttgggggccaggaaagcgaggtcaccgtggggggcctg
gagcctgggcgcaagtacaagatgcacctgtacggcctccacgaggggcagcgcctgggc
ccggtgtctgccgtgggcatcacagctccagaggatgaagctgagaccacccaagcagtg
cccaccacgacccctgagtcccccatcaagcctcgcctgggggagctgaccgtgacagat
gccacccctgactccctcagcctgtcctggacagttcccgagggccagtttgaccacttc
ctggtccagtacaggaatggggacgggcagcccaaggcggtgcgggtgccagggcacgag
gatgggatcaccgtctccggcctggagccagaccacaagtacaagatgaacctgtatggc
ttccacagtggccagcgcgtgggccctgtgtctgtcattggggtgacggctgcagaggaa
gagacccccagccccacagaacccagcactgaggccccagagccccctgaggagccgctc
ctgggggagctgacagtgacaggatcctcccctgactcgctgagcctctcctggaccatc
ccccagggccgcttcgactccttcaccgtgcagtacaaggacagggacgggcggccccag
gtggtgcgtgtcaggggcgaggagagcgaggtcactgtggggggcctggagcccaggcgc
aaatacaagatgcacctgtacggcctccacgaggggcggcgtgtgggcccggtgtccacc
gtgggtgtgacagatgatgaagccgagaccacccaagcagtgcccaccacgacccctgag
ccccccatcaagcctcgcctgggagagctgaccgtgacagatgccacccctgactccctc
agcctgacctggatggttcccgagggccagtttgaccacttcctagtccagtacaggaat
ggggacgggcagcccaaggcggtgcgggtgccagggcacgaggatgggatcaccatctca
ggcctggagccagaccaaaagtacaagatgaacctgtacggcttccatggtggccagcgc
atgggccctgtgtctgtcatcggggtgacggctgcagaggaagaaactcccgcccccaca
gaacccagcacggaggccccggagccccctgaggagccgctcctgggggagctgacagtg
acaggatcctcccctgactcgctgagcctctcctggaccgtcccccagggccgctttgac
tccttcaccgtgcagtacaaggacagggacgggcggccccaggtggtgcgtgtcgggggc
gaggagagcgaggtcaccgtggggggcctggagcaggggcgcaaatacaagatgcacctg
tacggcctccacgaggggcagcgcgtgggcccggtgtccgctgtgggtgtgacagctcca
gaggatgaagcggagaccacccaagcagtgcctaccacgacccctgagccccccatcaag
cctcacctgggggagctgactgtgacagatgccacccctgactccctcagcctgtcctgg
acagttcccgagggccagtttgaccacttcctggtccagtacaggaatggggacgggcag
cccaaggcggtgcgggtgccagggcatgaggatggggtcaccgtctccggcctggagcca
gaccacaagtacaagatgaacctgtacggcttccacggtggccagcgcgtgggccctgtg
tctgtaatcggggtgacagaggaagagaaccccagccccacggaacccagcactgaggcc
ccggagccccctgaggagccgctcctgggggagctgacagtgacaggatcctcccctgac
tcgctgagcctctcctggaccgtcccccagggtcgcttcgacttctttaccgtgcagtac
aaggacaggaatgggcagccccaggcggtgcgtgttgggggcgaggagagcgaggtcacc
gtgaggggcctggagccggggcgcaaatacaagatgcatctgtacggcctccacgagggg
cagcgcatgggcccagtgtccaccgttggcgtcacggcgcccctgcccacaccaccgccg
gtggagccccgcctgggggagctggccgtggcagccgtgacctcggactcagtgggcctt
tcatggacggtggcccagggcccctttgactccttcctggtgcagtatagggacgctcag
gggcagccccaggcagtgcctgtgagcggagacctccgagcagtcaccgtctcggggctg
gacccggcccgcaagtacaagttcctgctctttggactccagaatgggaaacgccacggc
ccagtccctgtggaggccaggaccgccccagacacgaaaccgtctccccacctgggggag
ctgactgtgacagatgcgacccctgactccgtgggcctctcgtggacggtccctgagggc
gaattcgactccttcgtgctccagtacaaggataaggacggtcagctccaggtggtgcca
gtggcagccaaccagcgggaggtcacagtccagggcctggagcccagtaggaaatacagg
ttcctgctctacggtctgtcaggcaggaagcgactgggccccatctctgctgagagcacc
acagcgccgctggagaaggagccacctccccgcctgggggaactgaccgtggctgaggag
acctccagctctctgcgcctgtcctggacggtggcccagggcccctttgactccttcgtg
gtccagtacagggacacggacgggcagcccagggcagtgcctgtggccgcagaccagcgc
acagtcaccatagaggacctggagcctggcaagaaatacaagtttctgctctacgggctc
ctcggggggaagcgcctgggtccggtctccgccctgggaatgacagccccagaagaggac
acgccagctccagagttangcccagaggcccctgagcctcctgaagagccccgcctagga
gtgctgaccgtgaccgacacaaccccagactccctgcgcctctcgtggagtgtggcccag
ggcccctttgattccttcgtggtccagtatgaggacaccaacgggcagccccaggccttg
ctcgtggacggcgaccagagcaagatcctcatctcaggcctggagcccagcaccccctac
aggttcctcctgtatggcctccatgaagggaagcgcctggggcccctctcagctgagggc
accacagggctggcccctgctggtcagacctcagcggagtcaaggccccgcctgtcccag
ctgtctgtgactgatgtgaccaccagttcactgaggctcaactgggaggccccacctggg
gccttcgactccttcctgctccgctttggggttccatcaccaagcaccctggagccgcat
ccgcgtccattgctgcagcgcgagctgatggtgcccggcacgcggcactcggccgtgctc
cgggacctgcgtccggggactctgtacagcctgacactgtatgggctgcgaggaccccac
aaggccgacagcatccagggcaccgcccgcaccctcagcccagttctggagagcccccgt
gacctccaattcagtgaaatcagggaggcctcagccaaggtcaactggatgnccccaccg
tcccgggcagacagcttcaaagtctcctaccagctggcggacggaggggagccgcagagc
atacaggtggacggccgggcccggacccagaaactccagggcntgatcccaggcgctcgc
tatgaggtgaccgtggtctccgtccgaggctttgaggagagtgagcctctcacaggcttc
ctcaccacggttcctgacgggccccacgcagtgcgtgcactgaacttgaccgagggattc
gccgtgctgcactggaagcccccccagaatcctgtggacacctatgacgtccaggtcaca
gcccctggggccccgcctctgcaggctgaggccccaggcagcgcggtggactaccccctg
cacgacctcgtcctccacaccaactacaccgccactgtgcgcggcctgcggggccccnac
ctcacttccccagccagcatcaccttcaccacagggctagaggcccctcgggacttggag
gccaaggaagtgaccccccgcacggccctgctcacttggactgagccccaattccggccc
acaggctacctgctcagcttcgacacccctggtggacagacccaggagatcctgctccca
ggagggatcacatctcaccagctcctcggcctctttccctccaccccctacaatgcacgg
ctccaggccatgtggggccagagcctcctgccgcccgtgtccacctctttcaccacgggt
gggctgtggatccccttccccagggactgcggggaggagatgcagaacggagccggtgcc
tccaggaccagcaccatcttcctcaacggcaaccgcgagcggcccctgaacgtgttttgc
gacatggagactgatgggggcggctggctggtgttccagcgccgcatggatggacagaca
gacttctggagggactgggaggactatgcccatggttttgggaacatctctggagagttc
tggctgggcaatgaggccctgcacagcctgacgcaggcaggtgactactccatgcgcgtg
gacctgcgggctggggacgaggctgtgttcgcccagtacgactccttccgcgtagactcg
gctgcggagtactaccgcctccacttggagggctaccacggcaccgcaggggactccatg
agctaccacagcggcagtgtcttctctgcccgtgatcgggaccccaacaacttgctcatc
tcctgcgctgtctcctaccgagggncctggtggtacaggaactgccactacgccaacctc
aacgggctctacgggagcaccgtggaccatcagggagtgagctggtactactggaagggc
ttcgagttctcggtgcccttcacggaaatgaagctgagaccaagaaactttcgctcccca
gcggggggaggctga

KEGG   Pongo abelii (Sumatran orangutan): 100451868
Entry
100451868         CDS       T01416                                 

Gene name
TNC
Definition
(RefSeq) tenascin isoform X4
  KO
K06252  tenascin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05165  Human papillomavirus infection
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100451868 (TNC)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100451868 (TNC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100451868 (TNC)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100451868 (TNC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100451868 (TNC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100451868 (TNC)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100451868 (TNC)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_Tenascin EGF_2 EGF Pur_ac_phosph_N DUF4998 DUF2369 hEGF fn3_2 Polyketide_cyc2
Other DBs
NCBI-GeneID: 100451868
NCBI-ProteinID: XP_002820188
Ensembl: ENSPPYG00000019537
UniProt: H2PT66
LinkDB
Position
9
AA seq 2201 aa
MRAMTQLLAGVFLAFLALTTEGGVLRKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPV
GSQCSVDLESVSGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGQCIDGQCICDEGFTGEDCSQLACPSDCNDQGKCVNGVCICFE
GYAGADCNREICPVPCSEEHGACVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKLTCPHACHSQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGQCECDDGFTGADCGELKCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGRCVDGQCVCEDGFAGPDCAELSCPNDCHGRG
RCVNGQCMCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQRSCPSDCNN
LGQCVSGRCICNEGYTGEDCLEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETTVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDMPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRDLEPGQEYNVLLTAEKGRHKSKPARVKASTERAPELENL
LVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAAQNLTVPGSLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAKVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSVEIAGLRAGT
PYTITLRGEVRGHSTQPLAVEVITEELPQLGDLVVSEVGWDGLRLNWTAADNAYEHFVIQ
VQEVNKVEAAQNLTLPGSLRAVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFNLSWTATDGIFETFTIEIIDSNRLRETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
LEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGRRSQPVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGTPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPA
TEYTLRIFAEKGPQKSATITAKFTTDLDSPRDLTATEVQSETALLTWRPARASVTGYLLV
YESVDGTVKEVIVGPDTTSHSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGRENFYQNW
KAYAAGFGDRKEEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
NT seq 6606 nt   +upstreamnt  +downstreamnt
atgagggctatgactcagctgttggcaggtgtctttcttgctttccttgccctcactacc
gaaggtggggtcctcaggaaagtcatccggcacaagcgacagagtggggtgaatgccacc
ctgccagaggagaaccagccagtggtgtttaaccatgtttacaacatcaagctgccggtg
ggatcccagtgttcggtggatctggagtcagtcagtggggagaaagacctggcaccacct
tcagagcccagtgaaagcttccaggagcacacagtggatggggaaaaccagattgtcttc
acacatcgcatcaacatcccccgccgggcctgtggctgtgctgcagcccctgatgttaag
gagctgctgagcagactggaggagctggagaacctggtgtcttccctgagagagcaatgt
actgcaggagcaggctgctgtctccagcctgccacaggccgtttggacaccaggcccttc
tgtagcggtcggggcaacttcagcactgaaggatgtggctgtgtctgcgaacctggctgg
aaaggccccaactgctctgagcccgaatgtccaggcaactgtcaccttcgaggccagtgc
attgatgggcagtgcatttgtgacgagggcttcacgggcgaggactgcagccagctggct
tgccccagcgactgcaatgaccagggcaagtgcgtgaatggagtctgcatctgttttgaa
ggctacgccggggctgactgcaaccgtgaaatctgcccggtgccctgcagtgaggagcac
ggcgcatgtgtagatggcttgtgtgtgtgccatgatggctttgcaggcgatgactgcaac
aagcctctgtgtctcaacaattgctacaaccgtgggcgatgcgtggagaatgagtgcgtg
tgtgatgaaggtttcacgggtgaagactgcagtgagctcatctgccccaatgactgcttc
gaccggggccgctgcatcaatggcacctgctactgcgaagaaggcttcacaggtgaagac
tgcgggaaactcacctgcccgcatgcctgccacagccagggccggtgcgaggaggggcag
tgtgtatgtgatgagggctttgccggtgtggactgcagcgagaagaggtgtcctgctgac
tgtcacaatcgtggccgctgtgtagatgggcagtgtgagtgtgatgatggtttcactgga
gctgactgtggggagctcaagtgtcccaatggctgcagtggccatggccgctgtgtcaat
gggcagtgtgtgtgtgatgagggctatactggggaggactgcagccagctacggtgcccc
aatgactgtcacagtcggggccgctgtgtcgagggcaaatgtgtatgtgagcaaggcttc
aagggctatgactgcagtgacatgagctgtcccaatgactgtcaccagcacggccgctgt
gtaaatggcatgtgtgtttgtgatgacggctacacaggggaagactgccgggatcgccaa
tgccccagggactgcagcaacaggggccgctgtgtggatggacagtgtgtctgtgaggac
ggcttcgccggccctgactgtgcagaactctcctgtccaaatgactgccatggccggggt
cgctgtgtgaacgggcagtgcatgtgccatgaaggattcatgggcaaagattgcaaggag
caaagatgtcccagtgactgtcatggccagggccgctgtgtggacggccagtgcatctgc
cacgagggcttcacaggcctggactgtggccagcgctcctgccccagtgactgcaacaac
ttaggacaatgcgtctcaggccgctgcatctgcaacgagggctacaccggagaagactgc
ttagaggtgtctcctcccaaagacctcgtcgtgacagaagtgacggaagagacggtcaac
ctggcctgggacaatgagatgcgggtcacagagtaccttgtcgtgtacacgcccacccac
gagggcggtctggaaatgcagttccgtgtgcctggggaccagacgtccaccatcatccgg
gagctggagcctggtgtggagtactttatccgtgtatttgccatcctggagaacaagaaa
agcattcctgtcagcgccagggtggccacgtacttgcctgcacctgaaggcctgaaattc
aagtccatcaaggagacaactgtggaagtggagtgggatcctctagacattgcttttgaa
acctgggagatcatcttccggaatatgaataaagaagatgagggagagatcaccaaaagc
ctgaggaggccagagacctcttaccggcaaactggtctagctcctgggcaagagtatgag
atatctctgcacatagtgaaaaacaatacccggggccctggcctgaagagggtgaccacc
acacgcttggatgcccccagccagatcgaggtgaaagatgtcacagacaccactgccttg
atcacctggttcaagcccctggctgagatcgacggcattgagctgacctatggcatcaaa
gacgtgccaggagaccgtaccaccatcgatctcacagaggacgagaaccagtactccatc
gggaacctgaagcctgacactgagtacgaggtgtccctcatctcccgcagaggtgacatg
tcaagcaacccagccaaagagaccttcacaacaggcctcgatgctcccaggaatcttcga
cgtgtttcccagacagataacagcatcaccctggaatggaggaatggcaaggcagctatt
gacagttacagaattaagtatgcacccatctctggaggggaccacgccgaggttgatgtt
ccaaagagccaacaagccacaaccaaaaccacactcacaggtctgaggccgggaactgaa
tatgggattggagtttctgctgtgaaggaagacaaggagagcaatccagcgaccatcaat
gcagccacagagttggacatgcccaaggaccttcaggtttctgaaactgcagagaccagc
ctgaccctgctctggaagacaccgttggccaagtttgaccgctaccgcctcaattacagt
ctccccacaggccagtgggtgggagtgcagcttccaagaaacaccacttcctatgtcctg
agagacctggaaccaggacaggagtacaatgtcctcctgacagccgagaaaggcagacat
aagagcaagcccgcacgtgtgaaggcatccactgaacgagcccctgagctggaaaacctc
ttggtgactgaggttggctgggatggcctcagactcaactggaccgcagctgaccaggcc
tatgagcactttatcattcaggtgcaggaggccaacaaggtagaggcagctcagaacctc
accgtgcctggcagccttcgggctgtcgacatcccgggcctcaaggctgccacgccttat
acagtctccatctatggggtgatccagggctatagaacaccagtgctctctgctgaggcc
tccacaggggaaactcccaatttgggagaggtcgtggtggccaaggtgggctgggatgcc
ctcaaactcaactggactgctccagaaggggcctatgagtactttttcattcaggtgcag
gaggctgacacagtagaggcagcccagaacctcacggtcccaggaggactgaggtccacg
gacctgcctgggctcaaagcagccactcattataccatcaccatccgcggggtcactcag
gacttcagcacaacccctctctctgttgaagtcttgacagaggaggttccagatatggga
aacctcacagtgaccgaggttagctgggatgctctcagactgaactggaccacgccagat
ggaacctatgaccagtttaccattcaggtccaggaggctgaccaggtggaagaagctcac
aatctcaccgttcctggcagcctgcgttccgtggaaatcgcaggcctcagggctggcact
ccttacacaatcaccctgcgcggcgaggtcaggggccacagcactcaaccccttgctgta
gaggtcatcacagaggagctcccacagctgggagatttagtggtatctgaggttggctgg
gatggcctcagactcaactggaccgcagctgacaatgcctatgagcactttgtcattcag
gtgcaggaggtcaacaaagtggaggcagcccagaacctcacgttgcctggcagcctcagg
gctgtggacatcccgggcctcgaggctgccacgccttatagagtctccatctatggggtg
atccggggctatagaacaccagtactctctgctgaggcctccacagccaaagaacctgaa
attggaaatttaaatgtttctgacataactcctgagagcttcaatctctcctggacagct
accgatgggatcttcgagacctttaccattgaaattattgattccaataggttgcgggag
actgtggaatataatatctctggtgctgaacgaactgcccatatctcagggctaccccct
agtactgattttattgtctacctctctggacttgctcccagcatccggaccaaaaccatc
agtgccacagccacgacagaggccctgccccttctggaaaacctaaccatttccgacatt
aatccctacgggttcacagtttcctggatggcatcggagaatgcctttgacagctttcta
gtaacggtggtggattctgggaagctgctggacccccaggaattcacactttcaggaacc
cagaggaagctggagcttagaggcctcataactggcattggctatgaggttatggtctct
ggcttcacccaagggcaccaaaccaagcccttgagggctgagattgttacagaagctgaa
ctggaagttgacaaccttctggtttcagatgccaccccagacggtttccgtctgtcctgg
acagctgatgaaggggtcttcgacaattttgttctcaaaatcagagataccaaaaagcag
tctgagccactggaaataaccctacttgcccccgaacgtaccagggacataacaggtctc
agagaggctaccgaatacgaaattgaactctatggaataagcaaaggaaggcgatcccag
ccagtcagtgctatagcaacaacagccatgggctccccaaaggaagtcattttctcagac
atcactgaaaactcagctactgtcagctggagggcacccactgcccaagtggagagcttc
cggattacctatgtgcccattacaggaggtacaccctccatggtaactgtggatggaacc
aagactcagaccaggctggtgaaactcatacctggggtagagtaccttgtcagcatcatc
gccatgaagggctttgaggaaagtgaacctgtctcagggtcattcaccacagctctggat
ggcccatctggcctggtgacagccaacatcactgactcggaagccttggccaggtggcag
ccagccattgccactgtggacagttatgtcatctcctacacaggggagaaagtgccagaa
attacacgcacggtgtccgggaacacagtggagtatgctctgaccgacctcgagcctgcc
acggaatacacactgagaatctttgcagagaaagggccccagaagagcgcaaccatcact
gccaagttcacaacagacctcgattctccaagagacttgactgctactgaggttcagtca
gaaactgccctccttacctggcgacccgcccgggcatcagtcaccggttacctgctggtc
tatgaatcggtggatggcacagtcaaggaagtcattgtgggtccagataccacctcccac
agcctggcggacctgagcccatccacccactacacggccaagatccaggcactcaatggg
cccctgaggagcaatatgatccagaccatcttcaccacaattggactcctgtaccccttc
cccaaggactgctcccaagcaatgctgaatggagacacgacctctggcctctacaccatt
tatctgaatggtgataaggctcaggcactggaagtcttctgtgacatgacctctgatggg
ggtggatggattgtgttcctgagacgcaaaaacggacgcgagaacttctaccaaaactgg
aaggcatatgctgctggatttggggaccgcaaagaagaattctggcttggtctggacaac
ctgaacaaaatcacagcccaagggcagtacgagctccgggtggacctgcgggaccatgga
gagacagcctttgctgtctatgacaagttcagtgtgggagatgccaagactcgctacaag
ctgaaggtggaggggtacagtgggacagcaggtgactccatggcctaccacaatggcaga
tccttctccacctttgacaaggacacagattcagccatcaccaactgtgctctgtcctac
aaaggggctttctggtacaggaactgtcaccgtgtcaacctgatggggagatatggggac
aataaccacagtcagggcgttaactggttccactggaagggccacgaacactcaatccag
tttgctgagatgaagctgagaccaagcaacttcagaaatcttgaaggcaggcgcaaacgg
gcataa

KEGG   Pongo abelii (Sumatran orangutan): 100452638
Entry
100452638         CDS       T01416                                 

Gene name
TNR
Definition
(RefSeq) tenascin-R isoform X1
  KO
K06252  tenascin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05165  Human papillomavirus infection
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100452638 (TNR)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100452638 (TNR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100452638 (TNR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100452638 (TNR)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100452638 (TNR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100452638 (TNR)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100452638 (TNR)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_Tenascin EGF_2 Pur_ac_phosph_N Uroplakin_II EGF
Other DBs
NCBI-GeneID: 100452638
NCBI-ProteinID: XP_024106938
Ensembl: ENSPPYG00000000482
LinkDB
Position
1
AA seq 1358 aa
MGADGETVVLKNMLIGVNLILLGSMIKSSECQLEVTTERVQRQSAEEEGGIANYNTSRKE
QPVVFNHVYNINVPLDSLCSSGLEASAEQEVSAEDETLAEYTGQTSDHESQVTFTHRINF
PKKACPCAGSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTAFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKIVYSTLAGEQYHEVLVPKGIGPTTRATLTDLVPGT
EYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGAITTGIDPPKDIAISNVTKDSVTVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLYPATEYEISLNSVRGREESERICTLVHTAMDNPVNLI
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTAWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYLIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNLEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQF
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgggggcagatggggaaacagtggttctgaagaacatgctcattggcgtcaacctgatc
cttctgggctccatgatcaagtcttcagagtgtcagctggaggtcaccacagaaagggtc
cagagacagtcagcggaggaggagggaggcattgccaactacaacacatcccgcaaagag
cagcctgtggtcttcaaccacgtgtacaacattaacgtgcccttggacagcctctgctcc
tcagggctagaggcctctgctgagcaggaggtgagtgcagaagatgagactctggcagag
tacacaggccagacctcagaccacgagagccaggtcacctttacacacaggatcaacttc
cccaaaaaggcctgcccatgtgccggttcagcccaggtgctgcaggagctgctgagccgg
atcgagatgctggagagggaggtgtcggtgctgagagaccagtgcaacgccaactgctgc
caagaaagtgctgccacaggacaactggactatatccctcactgcagtggccacggcaac
tttagctttgagtcctgtggctgcatctgcaacgaaggctggtttggcaagaattgctcg
gagccctactgcccgctgggttgctccagccggggggtgtgtgtggatggccagtgcatc
tgtgacagcgagtacagcggggatgactgttccgaactccggtgcccaacagactgcagc
tcccgggggctctgcgtggacggggagtgtgtctgtgaagagccctacactggcgaggac
tgcagggaactgaggtgccccggggactgttcggggaaggggagatgtgccaacggtacc
tgtttatgtgaggagggctacgttggtgaggactgcggccagcggcagtgtctgaatgcc
tgcagtgggcgaggacaatgtgaggaggggctctgcgtctgtgaagagggctaccagggc
cctgactgctcagcagttgcccctccagaggacttgcgagtggctggtatcagcgacagg
tccattgagctggaatgggacgggccgatggcagtgacggaatatgtgatctcttaccag
ccgacggccctggggggcctccagctccagcagcgggtgcctggagattggagtggtgtc
accatcacggagctggagccaggtctcacctacaacatcagcgtctacgctgtcattagc
aacatcctcagccttcccatcactgccaaggtggccacccatctctccactcctcaaggg
ctacaatttaagacgatcacagagaccaccgtggaggtgcagtgggagcccttctcattt
tccttcgatgggtgggaaatcagcttcattccaaagaacaatgaagggggagtgattgct
caggtccccagcgatgttacgtcctttaaccagacgggactaaagcctggggaggaatac
attgtcaatgtggtggctctgaaagaacaggcccgcagcccccccacctcggccagcgtc
tccacagtcattgacggccccacgcagatcctggttcgagatgtctctgacaccgtggct
tttgtggagtggattccccctcgagccaaagtcgatttcattctcttgaaatatggcctg
gtgggcggggaaggtgggaggaccgccttccgcctgcagcctcccctgagccaatactca
gtgcaggccctgcggcctggctcccgctacgaggtgtcagtcagtgccgtcagagggacc
aacgagagcgattctgccaccactcagttcacaacagagatcgatgcccccaagaacttg
cgagttggttctcgcacagcaaccagccttgacctcgagtgggataacagtgaggccgaa
gttcaggagtacaagattgtgtacagcaccctggcgggtgagcaatatcacgaggtactg
gtccccaagggcattggtccaaccaccagggccaccctgacagatctggtacccggcact
gagtatggagttggaatatctgccgtcatgaactcacagcaaagcgtgccagccaccatg
aatgccaggactgaacttgacagtccccgagacctcatggtgacagcctcctcggagacc
tccatctctctcatctggaccaaggccagtggccccattgaccactaccgaattaccttt
accccatcctctgggattgcctcagaagtcactgtacccaaggacaggacctcgtacaca
ctaacagatctagagcctggggcagagtacatcatttccatcactgctgagaggggtcgg
cagcagagcttggagtccactgtggatgctttcacaggcttccgtcccatctctcatctg
cacttttctcacgtgacctcctccagtgtgaacatcacttggagtgatccatctccccca
gcagacagactcattctgaactacagccccagggatgaggaggaagagatgatggaggtc
tccctggatgccaccaagaggcatgctgtcctgatgggcctgcaaccagccacagagtac
attgtgaaccttgtggctgtccatggcacagtgacctctgagcccattgtgggcgccatc
accacaggaattgatcccccaaaagacatcgcaattagcaatgtgaccaaggactcagtg
acggtctcctggagccctcctgttgcatctttcgattactaccgagtatcatatcgaccc
acccaagtgggacgactagacagctcagtggtgcccaacactgtgacagaattcaccatc
accagactgtacccagctaccgaatatgaaatcagtctcaacagcgtgcggggcagggag
gaaagcgagcgcatctgtactctcgtgcacacagccatggacaaccctgtgaatctgatt
gctaccaatatcactccaacagaagccttgctgcagtggaaggcaccagtgggtgaggtg
gagaactacgtcattgttcttacacactttgcagttgctggagagaccatcctggttgac
ggagtcagtgaggaatttcggcttgttgacctgcttcctagcacccactatactgccacc
atgtatgccaccaatgggcctctcaccagtggcaccatcagcaccaacttttctactctc
ctggaccctccggcaaacctgacagccagtgaagtcaccagacaaagtgccctgatctcc
tggcagcctcccagggcagagattgaaaattacgtcttgacctacaaatccaccgacgga
agccgcaaggagctgattgtggatgcagaagacacctggattcgactggagggcctgttg
gagaacacagactacacggtgctcctgcaggcagcacaggacactgcgtggagcagcatc
acctccaccgccttcaccacagggggccgggtgttccctcatccccaagactgtgcccag
catttgatgaatggagacactttgagcggggtttacctcatcttcctcaatggggagctg
agccagaaattacaagtgtactgtgatatgaccaccgacgggggcggctggattgtattc
cagaggcggcagaatggccaaactgattttttccggaaatgggctgattaccgtgttggc
ttcgggaacctggaggatgagttctggctggggctggacaacatacacaggatcacatcc
cagggccgctatgagctgcgtgtggacatgcgagatggccaggaggccgcctttgcctcc
tacgacaggttctctgtcgaggacagcagaaacttgtacaaactccgcataggaagctac
aacggcactgcaggggactccctcagctatcatcaaggacgccctttctccacagaggat
agagacaatgatgttgcagtgactaactgtgccatgtcgtacaagggagcgtggtggtat
aagaactgccaccggaccaacctcaatgggaagtacggagagtccaggcacagtcagggc
atcaactggtaccattggaaaggccacgagttctccatcccctttgtggaaatgaagatg
cgcccgtacaaccaccgtctcatggcagggagaaaacggcagtccttacagttctga

KEGG   Pongo abelii (Sumatran orangutan): 100453010
Entry
100453010         CDS       T01416                                 

Gene name
TNN
Definition
(RefSeq) tenascin-N isoform X1
  KO
K06252  tenascin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05165  Human papillomavirus infection
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100453010 (TNN)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100453010 (TNN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100453010 (TNN)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100453010 (TNN)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100453010 (TNN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100453010 (TNN)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100453010 (TNN)
SSDB
Motif
Pfam: fn3 Fibrinogen_C DUF4998 Pur_ac_phosph_N EGF_2 EGF_Tenascin
Other DBs
NCBI-GeneID: 100453010
NCBI-ProteinID: XP_024086930
Ensembl: ENSPPYG00000000484
LinkDB
Position
1
AA seq 1299 aa
MSLQEMFRFPLGLLLGSVLLAASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDA
DPQPLSDDGASLLALGEAGEEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMV
EMKEQCSAKRCCQGVTDLSRHCSGHGTFSLETCSCHCEEGREGPACERLACPGACSGHGR
CVDGRCLCHEPYVGADCGYPACPENCSGHGECVRGVCQCHEDFMSEDCSEKRCPGDCSGH
GFCDTGECYCEEGFTGLDCAQVVAPQGLQLLKNTEDSLLVSWEPSSQVDHYLLSYYPLGK
ELSGKQIQVPKEQHSYEILGLLPGTKYIVTLRNVKKEISSSPQHLLATTDLAVLGTAWVT
DETENSLDVEWENPSTEVDYYKLRYGPMTGQEVAEVTVPKSSDPKSRYDITGLHPGTEYK
ITVVPMRGELEGKPILLNGRTEIDSPTNVVTDRVTEDTATVSWDPVQAVIDKYVVRYTSA
DGDTKETAVHKDESSTVLTGLKPGEAYKVYVWAERGNQGSKKADTNALTEIDSPANLVTD
RVTENTATISWDPVQATIDKYVVRYTSADDQETREVLVGKEQSSTVLTGLRPGVEYTVHV
WAQKGDRESKKADTNTSTDIDSPKNLVTDRVTENMATVSWDPVQAAIDKYVVCYTSADGE
TRQVPVGKEQSSTVLTGLRPGMEYMVHVWAQKGDQESKKVDTKAQTDIDSPQNLVTDRVT
ENMATVSWDPVQATIDRYVVRYTSAKDGETREVPVGKEQSSTVLTGLRPGVEYTVHVWAQ
KGAQESKKADTKAQTDIDSPQNLVTDRVTENTATVSWDPVQATIDRYVVRYTSANGETRE
VPVGKEQSSTVLTGLRPGVEYTVHVWAQKGNQESKKADTKAQTEIDSPKNLVTGWVTENM
ATVSWDPVQATIDKYVVRYTSADGETREVPVGKEHSSTVLTGLRPGMEYMVHVWAQKGAQ
ESKKSDTKAQTELDPPRNLRPSAVTQSGGVLTWTPPSAEIHGYILTYQFPDGTVKEMQLG
REDQRFELQGLEQGATYPVSLVAFKGGRRSRNVSTTLSTVGARFPHPSDCSQVQQNSNAA
SGLYTIYLHGDASRPLQVYCDMDTDGGGWTVFQRRNTGQLDFFKRWRSYVEGFGDPMKEF
WLGLDKLHNLTTGTPMRYEVRVDLQTANESAYAIYDFFQVASSKERYKLTVGKYRGTAGD
ALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPW
KGHEFSIPYVELKIRPHGYSREPVLGRKKRTLGGRLRTF
NT seq 3900 nt   +upstreamnt  +downstreamnt
atgagtctccaggagatgttccgcttccctttggggctcctgcttggctctgtgctcctg
gcggcttcggccccagccactctggagcctcccggctgcagcaacaaggagcaacaggtc
actgtcagccacacctacaagatcgatgtgcccaagtctgccttggttcaggttgacgct
gaccctcagcccctcagtgacgatggggcttcgctcttggccctgggggaggccggggag
gaacagaacatcatcttcaggcacaacatccgccttcagacgccacagaaggactgtgag
ttggcaggcagtgtccaggacctcctggcccgggtgaagaagctggaggaagagatggtg
gagatgaaggaacagtgtagtgccaagcgctgctgccagggagtcactgatctaagccgc
cactgcagcggccacgggaccttctccctggagacctgcagctgccactgcgaggagggc
agggagggccccgcctgcgagcggctggcctgccccggggcgtgcagcggccacgggcgt
tgcgtggacgggcgctgcctgtgccatgagccctacgtgggtgccgactgcggctacccg
gcctgccctgagaactgcagcgggcacggcgagtgcgtgcgcggcgtatgccagtgccac
gaggacttcatgtcggaggactgcagcgagaagcgctgtcccggcgactgcagcggccac
ggcttctgcgacacgggcgagtgctactgcgaggagggcttcacaggcctggactgtgcc
caggtggttgccccacagggcctgcagctgctcaagaacacggaggattctctgctggtg
agctgggagccctccagccaggtggatcactacctccttagctactaccccctggggaag
gagctctctgggaagcagatccaagtgcccaaggagcagcacagctacgagattcttggt
ttgctgcctggaaccaagtatatagtcaccctgcgtaacgtcaagaaagaaatttctagc
agcccacagcatctacttgccaccacagaccttgctgtgcttggcactgcctgggtgaca
gatgagactgagaactccctcgacgtggagtgggaaaacccctcgactgaggtggactac
tacaagctgcgatatggtcccatgacagggcaggaggtagccgaggtcactgtgcccaag
agcagtgaccccaagagccgatatgacatcactggtctgcacccggggaccgagtataag
atcacggtggtgcccatgagaggagagctggagggcaagccgatcctcctgaatggcagg
acagaaattgacagtccaaccaatgttgtcaccgatcgagtgactgaagacacagcaact
gtctcctgggacccagtgcaggctgtcatagacaagtatgtggtgcgctacacctctgct
gatggggacaccaaggaaacggcagtgcacaaggacgagagcagcactgtcctgacgggc
ctgaagccaggagaggcatacaaggtttacgtgtgggctgaaaggggcaaccaggggagc
aagaaagctgacaccaatgcccttacagaaattgacagcccagcaaacctggtgactgac
cgggtgactgagaataccgccaccatctcctgggacccggtgcaggccaccattgacaag
tatgtggtgcgctacacctctgctgatgaccaagagaccagagaggttctggtggggaag
gagcagagcagcactgtcctgacaggcctgaggccaggtgtggagtacacagtgcatgtc
tgggcccagaagggggaccgagagagcaagaaggctgacaccaacacctcgacagacatt
gacagccccaaaaacctggtgactgaccgggtgacagagaatatggccactgtctcctgg
gacccggtgcaggctgccattgacaagtacgtggtatgctacacctctgccgatggagag
accaggcaggttccggtggggaaggagcagagcagcactgtcctgacaggcctgagaccg
ggcatggagtacatggtgcatgtgtgggcccagaagggggaccaggagagcaagaaggtc
gacaccaaggcccagacagacattgacagcccccaaaacctggtgactgaccgggtgaca
gagaatatggccactgtctcctgggacccggtgcaggccaccattgacaggtatgtggtg
cgctacacctctgccaaggacggagagaccagggaggttccggtggggaaggagcagagt
agcactgtcctgacgggcctgaggccgggtgtggagtacacagtgcacgtgtgggcccag
aagggggcccaggagagcaagaaggctgacaccaaggcccagacagacattgacagcccc
caaaacctggttactgaccgggtgacagagaatacagccactgtctcctgggacccggtg
caggccaccattgacaggtatgtggtgcgctacacgtcagccaacggagagaccagggag
gttccagtggggaaggagcagagcagcactgtcctgacgggcctgaggccaggcgtggag
tacacggtgcacgtgtgggcccagaaggggaaccaggagagcaagaaggctgacaccaag
gcccagacagaaattgacagccccaaaaacctggtgactggctgggtgacagagaatatg
gccactgtctcctgggacccggtgcaggccaccattgacaagtatgtggtgcgctacacc
tctgccgacggggagaccagggaggttccggtggggaaggagcacagcagcaccgtcctg
acgggcctgagaccaggcatggagtacatggtgcacgtgtgggcccagaagggggcccag
gagagcaagaagtctgacaccaaggcccagacagaactcgaccctcccagaaaccttcgt
ccatctgctgtaacgcagtctggtggcgtattgacctggacgcccccctctgctgagatc
catggctacattctgacctaccagttcccagacggcacagttaaggagatgcagctggga
cgagaagaccagaggtttgagttgcaaggccttgagcaaggcgccacctaccctgtctcc
cttgttgcctttaagggtggtcgccggagcagaaatgtatccaccaccctctccacagtt
ggtgcccgtttcccacacccttcggactgcagtcaggttcagcagaacagcaatgccgcc
agtggtctgtacaccatctacctgcacggcgatgccagccggcccctgcaggtgtactgt
gacatggacacggatggaggtggctggactgtcttccaaaggcggaacactgggcagctg
gatttcttcaagcgatggaggagctatgtggaaggctttggggaccccatgaaggagttc
tggcttggacttgacaagctacacaacctcaccaccggcactccaatgcggtatgaagtg
agagtggatttacagactgccaatgaatctgcctatgctatatatgatttcttccaagtg
gcctccagcaaggagcggtataagctgacagttgggaaatacagaggcacggcaggggat
gctcttacttaccacaatggatggaagtttacaactttcgacagagacaacgatattgca
ctcagcaactgtgccctgacgcatcatggtggctggtggtataagaactgccacttggcc
aaccccaatggcagatatggggagaccaagcacagtgagggggtgaactgggagccttgg
aaaggacatgaattctccattccttacgtggagttgaaaatccgccctcatggctacagc
agggagcctgtcctgggcagaaagaagcggacgctgggaggaaggctgcgaacgttctga

DBGET integrated database retrieval system