KEGG   Pongo abelii (Sumatran orangutan): 100443606
Entry
100443606         CDS       T01416                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100443606 (AREG)
   04012 ErbB signaling pathway
    100443606 (AREG)
   04390 Hippo signaling pathway
    100443606 (AREG)
   04151 PI3K-Akt signaling pathway
    100443606 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100443606 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100443606 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100443606 (AREG)
Chaperones and folding catalysts [BR:pon03110]
 Intramolecular chaperones
  Others
   100443606 (AREG)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100443606 (AREG)
SSDB
Motif
Pfam: FtsL EGF
Other DBs
NCBI-GeneID: 100443606
NCBI-ProteinID: XP_002814920
Ensembl: ENSPPYG00000014838
UniProt: H2PDL7
LinkDB
Position
4
AA seq 252 aa
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSELSSGADYDYPEEYDNEPQIPGYIVDDSVRVEQVVKPPKNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAIAVITVQLRRRYIRKYEGEAEERKK
LRQENGNVHVIA
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagagccccgctgctaccgccagcgccggtggtgctgtcgctcttgatactcggctca
ggccattatgctgctggattggacctcaatgacacctactctgggaagcgtgaaccattt
tctggggatcacagtgctgatggatttgaggttacctcaagaagtgagatgtcttcagga
agtgagatttcccctgtgagtgaaatgccttctagtagtgaactgtcctcgggagccgac
tatgactacccagaagagtatgataatgaaccacaaatacctggctatattgtcgatgat
tcagtcagagttgaacaggtagttaagccccccaaaaacaagacggaaagtgaaaatact
tcagataaacccaaaagaaagaaaaagggaggcaaaaatggaaaaaatagaagaaacaga
aagaagaaaaatccatgtaatgcagaatttcaaaatttctgcattcacggagaatgcaaa
tatatagagcacctggaagcagtaacatgcaaatgtcagcaagaatatttcggtgaacgg
tgtggggaaaagtccatgaaaactcacagcatgattgacagtagtttatccaaaattgca
ttagcagccatagctgcctttatgtctgctgtgatcctcacagctattgctgttattaca
gtccagcttagaagacgatacatcaggaaatatgaaggagaagctgaggaacgaaagaaa
cttcgacaagagaatggaaatgtacatgttatagcataa

DBGET integrated database retrieval system