KEGG   Pongo abelii (Sumatran orangutan): 100443647Help
Entry
100443647         CDS       T01416                                 

Definition
(RefSeq) trypsin-2 isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04080  Neuroactive ligand-receptor interaction
pon04972  Pancreatic secretion
pon04974  Protein digestion and absorption
pon05164  Influenza A
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100443647
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100443647
   04974 Protein digestion and absorption
    100443647
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    100443647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pon01002]
    100443647
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100443647
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100443647
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100443647
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100443647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 100443647
NCBI-ProteinID: XP_024105362
LinkDB All DBs
Position
7
AA seq 261 aa AA seqDB search
MNPLLILTFVAAAAAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSPINPKFSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSWTLDN
DILLIKLSTPAVINARVSTISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVL
TQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGQLQGIVSWGYGCAQKNRP
GVYTKVYNYVDWIKDTIAANS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacttctgatccttacctttgttgcagctgctgctgctgccccctttgatgat
gatgacaagatcgttgggggctacacctgtgaggagaattctgtcccctaccaggtgtcc
ctgaattctggctaccacttctgcggtgggtccctcatcagcgaacagtgggtggtgtca
gcaggtcactgctacaagtcgccaatcaacccaaaattttcaggaagagggtgtgaatat
caccgcatccaggtgagactgggagagcacaacatcgaagttctggaggggaatgagcag
ttcatcaatgcagccaagatcatccgccaccccaaatacaacagctggactctggacaat
gacatcctgctgatcaagctctccacacctgccgtcatcaatgcccgcgtgtcaaccatc
tctctgcccaccgcccctccagctgctggcaccgagtccctcatctccggctggggcaac
actctgagctctggtgccgactacccagacgagctgcagtgcctggatgctcctgtgctg
acccaggctgagtgtgaagcctcctaccctggaaagattaccaacaacatgttctgtgtg
ggcttcctcgagggaggcaaggattcctgccagggtgactctggtggccctgtggtctcc
aatggacagctccaaggaattgtctcttggggctatggctgtgcccagaagaacaggcct
ggagtctacaccaaggtctacaactatgtggactggattaaggacaccatagctgccaac
agctaa

DBGET integrated database retrieval system