KEGG   Pongo abelii (Sumatran orangutan): 100443901
Entry
100443901         CDS       T01416                                 

Gene name
SIRT1
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-1 isoform X1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00760  Nicotinate and nicotinamide metabolism
pon01100  Metabolic pathways
pon04068  FoxO signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04922  Glucagon signaling pathway
pon05031  Amphetamine addiction
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100443901 (SIRT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100443901 (SIRT1)
   04152 AMPK signaling pathway
    100443901 (SIRT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100443901 (SIRT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100443901 (SIRT1)
  09149 Aging
   04211 Longevity regulating pathway
    100443901 (SIRT1)
   04213 Longevity regulating pathway - multiple species
    100443901 (SIRT1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100443901 (SIRT1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100443901 (SIRT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100443901 (SIRT1)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100443901 (SIRT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     100443901 (SIRT1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     100443901 (SIRT1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100443901 (SIRT1)
SSDB
Motif
Pfam: SIR2 DUF592
Other DBs
NCBI-GeneID: 100443901
NCBI-ProteinID: XP_002820941
Ensembl: ENSPPYG00000002401
LinkDB
Position
10
AA seq 747 aa
MADEAALALQPGGSPSAAGAEREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAAGGCPAAAAALWREAEAEAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNFYD
EDDDDDEGEEEEEAAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHISEDSSS
PERSSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVTGTVRKCWPNRVAKEQISKRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAIDEAISMKQEVTDMNYPSNKS
NT seq 2244 nt   +upstreamnt  +downstreamnt
atggcggacgaggcggccctcgcccttcagcccggcggctccccctcggcggcgggggcc
gagagggaggccgcgtcgtcccccgccggggagccgctccgcaagaggccgcggagagac
ggtcccggcctcgagcggagcccgggcgagcccggtggggcggccccagagcgtgaggtg
ccggcggcggccgggggctgcccggctgcggcggcggcgctgtggcgggaggcggaggca
gaggcggcggcgggcggggagcaagaggcccaggcgactgcggcggctggggaaggagac
aatgggccgggcctgcagggcccatctcgggagccaccgctggccgacaacttctacgac
gaagacgacgacgacgacgagggcgaggaggaggaagaggcggcggcggcggcggcgatt
gggtaccgagataaccttctgttcggtgatgaaattatcactaatggttttcattcctgt
gaaagtgatgaggaggatagagcctcacatgcaagctctagtgactggactccgaggcca
cggataggtccatatacttttgttcagcaacatcttatgattggcacagatcctcgaaca
attcttaaagatttattgccggaaacaattcctccacctgagttggatgatatgacactg
tggcagattgttattaatatcctttcagaaccaccaaaaaggaaaaaaagaaaagatatt
aatacaattgaagatgctgtgaaattactgcaagagtgcaaaaaaattatagttctaact
ggagctggggtgtctgtttcatgtggaatacctgacttcaggtcaagggatggtatttat
gctcgccttgctgtagacttcccagatcttccagatcctcaagcgatgtttgatattgaa
tatttcagaaaagatccaagaccattcttcaagtttgcaaaggaaatatatcctggacaa
ttccaaccatcactctgtcacaaattcatagccttgtcagataaggaaggaaaactacta
cgcaactatacccagaacatagacacgctggagcaggttgcaggaatccaaaggataatt
cagtgtcatggttcctttgcaacagcatcttgcctgatttgtaaatacaaagttgactgt
gaagctgtacgaggagatatttttaatcaggtagttcctcgatgtcctaggtgcccagct
gatgaaccgcttgctatcatgaaaccagagattgtgttttttggtgaaaatttaccagaa
cagtttcatagagccatgaagtatgacaaagatgaagttgacctcctcattgttattggg
tcttccctcaaagtaagaccagtagcactaattccaagttccataccccatgaagtgcct
cagatattaattaatagagaacctttgcctcatctgcattttgatgtagagcttcttgga
gactgtgatgtcataattaatgaattgtgtcataggttaggtggtgaatatgccaaactt
tgctgtaaccctgtaaagctttcagaaattactgaaaaacctccacgaacacaaaaagaa
ttggcttatttgtcagagttgccacccacacctcttcatatttcagaagactcaagttca
ccagaaagaagttcaccaccagattcttcagtgattgtcacacttttagaccaagcagct
aagagtaatgatgatttagatgtgtctgaatcaaaaggttgtatggaagaaaaaccacag
gaagtacaaacttctaggaacgttgaaagtattgctgaacagatggaaaatccggatttg
aagaatgttggttccagtactggggagaaaaatgaaagaacttcagtgactggaacagtg
agaaaatgctggcctaatagagtggcaaaggagcagattagtaagcggcttgatggtaat
cagtatctgtttttgccaccaaatcgttacattttccatggcgctgaggtatattcagac
tctgaagatgacgtcttatcctctagttcttgtggcagtaacagtgatagtgggacatgc
cagagtccaagtttagaagaacccatggaggatgaaagtgaaattgaagaattctacaat
ggcttagaagatgagcctgatgttccagagagagctggaggagctggatttgggactgat
ggagatgatcaagaggcaattgatgaagctatatctatgaaacaggaagtaacagacatg
aactatccatcaaacaaatcatag

DBGET integrated database retrieval system