KEGG   Pongo abelii (Sumatran orangutan): 100444262
Entry
100444262         CDS       T01416                                 

Gene name
RAPGEF1
Definition
(RefSeq) rap guanine nucleotide exchange factor 1 isoform X1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04510  Focal adhesion
pon04722  Neurotrophin signaling pathway
pon04910  Insulin signaling pathway
pon05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100444262 (RAPGEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444262 (RAPGEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100444262 (RAPGEF1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100444262 (RAPGEF1)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100444262 (RAPGEF1)
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 100444262
NCBI-ProteinID: XP_024107959
Ensembl: ENSPPYG00000019705
LinkDB
Position
9
AA seq 1233 aa
MSGGLGLRRSPEMSGKIEKADSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKI
PEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVSA
LRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLA
NLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSS
PAGKPDGPAELPLTDREVEILNKTTGMSQSTELLPDATDEEVAPPKPPLPGIRVVDNSPP
PALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDVDCYAQRRLSGGSHSYGG
ESPRLSPCSSIGKLSKSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQI
PQQTAWNLSPLPESLGESGSPFLGPPFQLPLGGHPQPDGPLAPGQQTDTPPALPEKKRRS
AASQTADNSGCRVSYERHPSQYDNISGEDLQSTAPVPSVSYAPFAAILPFQHGGSSAPVE
FVGDFTAPESTGDPEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQNEHIYQQKN
KLLMEVYGFSDSFSGADSVQELAPPPALPPKQRQLQASCAASSFSSVSYCVQQTKVAFTP
EDGSAAQGLSVSVSNSFLSRHGSLPVPSYKSVFRSYSQDFVPHHQASVPPFLPPTSSSSP
HFPPAHQSQSSDLAVPTMAGPPPSTVDGPLSASQESSFHGNTVCLPSETSFTDSEPPAGK
DGHPRDPSAVSGVPGKDGRDGNERAPKSPDALESAQSEEEVDELSLIDHNEIMSRLTLKQ
EGDDGPDVRGGSGDILLVHATETDRKDLVLYCEAFLTTYRTFISPEELIKKLQYRYEKFS
PFADTFKKRVSKNTFFVLVRVVDELCLVELTEEILKLLMELVFRLVCNGELSLARVLRKN
ILDKVDQKKLLRCATSSQPLAARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEV
LLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLN
NFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPY
LGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQAHYDIRRNDDIINFFND
FSDHLAEEALWELSLKIKPRNITRRKTDREEKT
NT seq 3702 nt   +upstreamnt  +downstreamnt
atgagcggcggcctcggcctccggcgcagcccggaaatgtccggcaagatcgagaaagca
gactctcagcgttctcatctctcttccttcaccatgaagctgatggacaaattccactca
cccaaaatcaagagaacgccatcaaagaagggaaaaccagctgaggtgtccgtaaagatt
ccagagaagcctgtgaacaaagaggcaacagacagatttctaccagagggctaccctctc
cccttggatctggagcagcaggcagtagaatttatgtccaccagtgctgtggcttccagg
tctcaaaggcagaagaacctgagctggctggaggagaaagagaaggaagttgtcagtgcc
ctgcgctactttaagaccattgtggacaaaatggcaattgataagaaggtactggagatg
cttccagggtcagccagcaaggtgctggaggccatcttacccctggtgcagaacgatcct
cgaattcagcacagctcagccctctcttcctgctatagccgagtgtaccaaagtctcgcc
aacctcattcgctggtctgaccaagtgatgctggaaggtgtgaactcagaagacaaggag
atggtgacgactgtgaagggggtcatcaaggctgtgctggatggagtgaaggagctggtc
aggctcaccatcgagaagcagggacgtccgtctccgacgagccccgtgaagcccagttcc
cctgccggcaagcctgatggcccagcagagcttcccctgacggaccgcgaggtagagatc
ctaaacaagacgactgggatgtcacagtcaactgagctcctcccagatgccacggatgaa
gaggtcgcgccccccaagcctcccctgcctggcattcgggtggttgataatagtcctcca
ccagcattgccacccaagaaaagacagtcggcgccgtcccctacccgagtggctgtggtg
gcccccatgagccgagccaccagtggctccagtttgcctgttggaatcaataggcaggat
tttgatgttgactgttatgcacagaggcgactgtcaggaggcagccactcgtatggtgga
gagtcgccccgcctctccccctgcagcagcataggcaagctcagcaagtcagacgagcag
ctgtcctctctggacagggacagtgggcagtgctcccggaacacaagctgtgaaacacta
gaccactatgatcccgactatgaattcctccagcaagacctctctaacgcagaccagata
cctcagcagacggcctggaaccttagcccgttgccagagtctttgggggagtctgggtct
ccatttcttggccctcctttccagctgcctcttggtggccatccccagccagatggacct
ctggccccagggcagcagacagatacgccacctgctctccccgagaagaagcgcaggagc
gcagcctcccagacggcggacaactctggctgcagggtgtcctacgagcggcatccctcg
cagtatgacaacatctctggggaggacctgcagagcacagccccggtcccatccgtctcc
tacgcgccctttgctgctattctgccctttcagcatggaggttcctcagcccctgtcgaa
tttgtgggtgattttactgctcctgaatcaacgggtgacccagaaaaaccacctcctcta
ccagagaagaaaaacaaacacatgctggcctacatgcagttgctggaggactactcggag
ccacagccctctatgttctaccagacgccgcagaacgagcacatctaccagcagaagaac
aagctcctcatggaggtatacggcttcagcgactccttcagtggggcggactccgtgcag
gagctggccccgccgcccgccctaccccccaagcagcggcagctgcaggcctcctgtgct
gcttcttccttctcctctgtctcctactgtgtccagcaaactaaagtggccttcaccccc
gaggacggcagtgccgctcagggcctcagtgtgtccgtctctaactcctttctcagccgg
cacggcagcttgcccgtgccctcgtataagtctgtgtttaggtcctactcccaggatttc
gtgcctcaccaccaagcttccgttccgcctttccttccgcctacctcctcttcctctcca
catttcccacctgcccaccagtctcagagctctgacttagccgtgccaaccatggccggt
ccacctcccagcaccgtggacgggcctctctcggcttctcaggagagcagctttcatggg
aatactgtctgccttccttccgaaacctctttcactgactcggagccaccggctgggaaa
gacggacatcccagagatccctcagcggtcagcggcgtccctgggaaggacggcagagac
ggcaatgagagggccccaaagtcaccagatgctctggagtcggctcagtcagaggaggaa
gtggacgagctgtccctcatcgaccacaacgaaattatgtccaggctgacgctcaagcag
gagggtgatgacgggccggacgtccgcggaggatctggggacatcttattggtccatgct
actgagactgacaggaaagatttggtgttgtactgcgaggcgttcctgaccacctacagg
accttcatctccccagaggagctcatcaagaagctgcagtacagatacgagaaattctct
ccctttgccgacacattcaagaagcgcgtcagcaagaacacgttcttcgtgctggtacgg
gtggtggatgagctgtgcctggtggagttgacagaagagatcctgaagctgctgatggaa
ctggtcttccgcctggtgtgcaacggggagctgagcctggctcgtgtgctccggaagaac
atcctggacaaagtggaccagaagaagctactcaggtgtgccacctccagccagcccctg
gcggcccggggggtagcagccaggccggggaccttgcacgactttcacagccatgagata
gcggagcagctaacgctgctggatgctgagctcttctataaaatagagattcctgaggtt
ttgctttgggcaaaagagcagaatgaggagaagagccccaacttgacccagttcacggag
cacttcaacaacatgtcctactgggtccggtccataatcatgttacaggaaaaggcccag
gacagggaacggctgctcttgaagttcatcaagatcatgaagcacttgcggaagctgaat
aacttcaactcctacttggccatcctctctgccctggactcggcgcccatccgcaggctg
gagtggcagaagcagacttcagagggcctggccgagtactgcacactgatcgacagctcg
tcctccttccgagcctaccgggccgccctctcggaggtggaaccgccgtgcatcccgtac
ctggggctgatcctgcaggacctgaccttcgttcacctgggaaacccagactacatcgac
gggaaagtgaacttctccaagcggtggcagcagttcaacatcctcgacagcatgcggtgc
ttccagcaggcgcactatgacatccggaggaacgacgacattataaacttcttcaatgac
ttcagtgaccacctggctgaggaggccctatgggaactttctctgaaaattaaacccagg
aacataacaaggagaaaaacagaccgggaagagaaaacctag

DBGET integrated database retrieval system