KEGG   Pongo abelii (Sumatran orangutan): 100444448
Entry
100444448         CDS       T01416                                 

Gene name
TP63
Definition
(RefSeq) tumor protein 63 isoform X1
  KO
K10149  tumor protein p63
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100444448 (TP63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100444448 (TP63)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100444448 (TP63)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 Mtf2 Forkhead_N
Other DBs
NCBI-GeneID: 100444448
NCBI-ProteinID: XP_002814454
Ensembl: ENSPPYG00000014401
UniProt: H2PCB7 A0A663DG87
LinkDB
Position
3
AA seq 680 aa
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEGGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSQSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDARRNKQQRIKEEGE
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgaattttgaaacttcacggtgtgccaccctacagtactgccctgacccttacatccag
cgtttcgtagaaaccccagctcatttctcttggaaagaaagttattaccgatccaccatg
tcccagagtacacagacaaatgaattcctcagtccagaggttttccagcatatctgggat
tttctggaacagcctatatgttcagttcagcccattgacttgaactttgtggatgaacca
tcagaaggtggtgcaacaaacaagattgagattagcatggactgtatccgcatgcaggac
tcggacctgagtgaccccatgtggccacagtacacgaacctggggctcctgaacagcatg
gaccagcagattcagaacggctcctcgtccaccagtccctataacacagaccacgcgcag
aacagcgtcacggcgccctcgccctacgcgcagcccagctccaccttcgatgccctctcg
ccgtcacccgccatcccctccaacaccgactacccaggcccgcacagtttcgacgtgtcc
ttccagcagtcgagcaccgccaagtcggccacctggacgtattccactgaactgaagaaa
ctctactgccaaattgcaaagacatgccccatccagatcaaggtgatgaccccgcctcct
cagggagctgttatccgcgccatgcctgtctacaaaaaagctgagcacgtcactgaggta
gtgaagcgatgccccaaccatgagctgagccgtgaattcaacgagggacagattgcccct
cctagtcatttgattcgagtagaggggaacagccatgcccagtatgtagaagaccccatc
acaggaagacagagtgtgctggtaccttatgagccaccccaggttggcactgaattcacg
acagtcttgtacaatttcatgtgtaacagcagttgtgttggagggatgaaccgccgtcca
attttaatcattgttactctggaaaccagagatgggcaagtcctgggccgacgctgcttt
gaggcccggatctgtgcttgcccaggaagagacaggaaggcggatgaagatagcatcaga
aagcagcaagtttcggacagtacaaagaacggtgatggtacgaagcgcccgtttcgtcag
aacacacatggtatccagatgacatccatcaagaaacgaagatccccagatgatgaactg
ttatacttaccagtgaggggccgtgagacttatgaaatgctgttgaagatcaaagagtcc
ctggaactcatgcagtaccttcctcagcacacaatcgaaacgtacaggcaacagcaacag
cagcagcaccagcacttacttcagaaacagacctcaatacagtctcaatcttcatatggt
aacagctccccacctctgaacaaaatgaacagcatgaacaagctgccttctgtgagccag
cttatcaaccctcagcagcgcaacgccctcactcctacaaccattcctgatggcatggga
gccaacattcccatgatgggcacccacatgccaatggctggagacatgaatggactcagc
cccacccaggcactccctcccccactctccatgccatccacctcccactgcaccccccca
cctccgtatcccacagattgcagcattgtcagtttcttagcgaggttgggctgttcatca
tgtctggactatttcacgacccaggggctgaccaccatctatcagattgagcattactcc
atggatgatctggcaagtctaaaaatccctgagcaatttcgacacgcaatctggaagggc
atcctggaccaccggcagctccacgaattctcctcaccttctcatctcctgcggacccca
agcagtgcctctacagtcagtgtgggctccagtgagacccggggtgagcgtgttattgat
gctgtgcggttcaccctccgccagaccatctctttcccaccccgagatgagtggaatgac
ttcaactttgacatggatgctcgccgcaataagcaacagcgcatcaaagaggagggggag
tga

DBGET integrated database retrieval system