KEGG   Pongo abelii (Sumatran orangutan): 100444645
Entry
100444645         CDS       T01416                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X2
  KO
K05459  insulin-like growth factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04114  Oocyte meiosis
pon04115  p53 signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100444645 (IGF1)
   04014 Ras signaling pathway
    100444645 (IGF1)
   04015 Rap1 signaling pathway
    100444645 (IGF1)
   04066 HIF-1 signaling pathway
    100444645 (IGF1)
   04068 FoxO signaling pathway
    100444645 (IGF1)
   04151 PI3K-Akt signaling pathway
    100444645 (IGF1)
   04152 AMPK signaling pathway
    100444645 (IGF1)
   04150 mTOR signaling pathway
    100444645 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100444645 (IGF1)
   04115 p53 signaling pathway
    100444645 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444645 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100444645 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100444645 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100444645 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100444645 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100444645 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100444645 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100444645 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100444645 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100444645 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444645 (IGF1)
   05202 Transcriptional misregulation in cancer
    100444645 (IGF1)
   05205 Proteoglycans in cancer
    100444645 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100444645 (IGF1)
   05218 Melanoma
    100444645 (IGF1)
   05215 Prostate cancer
    100444645 (IGF1)
   05224 Breast cancer
    100444645 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100444645 (IGF1)
   05414 Dilated cardiomyopathy
    100444645 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100444645 (IGF1)
   01522 Endocrine resistance
    100444645 (IGF1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100444645 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100444645
NCBI-ProteinID: XP_002823703
Ensembl: ENSPPYG00000004882
UniProt: A0A663DE66 A0A2J8XMA1
LinkDB
Position
12
AA seq 159 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRRKGSTFEEHK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcactgtgcctgctc
accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgaggaggctggagatgtattgtgcacccctcaagcctgccaaatcagcccgctct
gtccgtgcccagcgccacaccgacatgcccaagacccagaagtatcagcccccatctacc
aacaagaacacgaagtctcagaggagaaggaaaggaagtacatttgaagaacacaagtag

DBGET integrated database retrieval system