KEGG   Pongo abelii (Sumatran orangutan): 100444744
Entry
100444744         CDS       T01416                                 

Gene name
ZFPM2
Definition
(RefSeq) zinc finger protein ZFPM2 isoform X1
  KO
K17442  zinc finger protein ZFPM2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100444744 (ZFPM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100444744 (ZFPM2)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    100444744 (ZFPM2)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-C2H2 zf-C2H2_4 zf-met zf-C2H2_8
Other DBs
NCBI-GeneID: 100444744
NCBI-ProteinID: XP_009242297
LinkDB
Position
8
AA seq 1151 aa
MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEV
EYFCNKGDDGGIQETAESDGDSQSEKPGQPGVETDDWDGPGELEVFQKKGERKIQSRQQL
PVGTTWGPFPGKMDLNNNSLKTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQ
LWCTTTKAISEGEELIAFVVDFDSRLQAASQMTVTEGMYPARLLDSIQLLPQQAAMASIL
PTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREAAPVSEENEDSAHQISSLCPF
PQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINFHQHLFSHLTQ
AAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSGTEDSLQPATDLLTRSEL
PQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLA
SSPVQPNMGPSFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIY
SPLMPKGATCFECNITFNNLDNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTG
QTSINLLNPAAHSADPENPLLQTSCINSSTVLDLIGPNGKGHDKDFSTQTKKLSTSSNND
DKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHETYMVHKQYYCATRHDPPLKR
SASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDIANLNNPCTSTQEPTEGL
GECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSNVSCLEMDVPIDLSKKCLSQS
ERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDSKVFPNPES
ERNSPDVSYERSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRH
LFLPQCLYPGAIKKAKGADQLSPYYGIKPSDYISGSLVIHNTDIEQSTNAENESPKGQAS
SNGCAALKKDSLPLLPKNRGMVIVNGGLKQDERPAANPQQENISQNPQHEDDHKSPSWIS
ENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCDIQFNNLSNFITHKKF
YCSSHAAEHVK
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgtcccggcgaaagcaaagcaaaccccggcagatcaaacggccacttgaagatgccatt
gaagatgaggaagaagaatgtccatcagaggaaacagacatcatctccaaaggagacttt
ccattggaggaaagcttttccacagaatttgggcctgaaaatctgagctgtgaagaagtg
gaatacttttgtaacaaaggtgatgatggaggaatccaggagacagcagaatcagatggg
gactcacagtcagaaaaaccggggcaacctggagttgagacagatgactgggatggacca
ggagagctggaggtgtttcagaaaaaaggggaacgaaaaattcagagtcgacagcaactt
ccagtgggaacaacctgggggccgtttcctgggaagatggacttgaataataattctttg
aagacaaaggctcaggtcccaatggtgctgactgctggtcccaagtggttgctggatgtg
acttggcaaggagtggaagacaacaaaaacaactgcattgtgtacagcaaagggggtcag
ctttggtgtaccactacgaaggccatctctgagggtgaagagctaattgcctttgtggta
gattttgactcaaggctacaagctgccagtcagatgactgtcacagaagggatgtaccct
gcacgcctgctggactcaattcagctgcttcctcagcaagctgccatggcttctattttg
cccacagctattgtcaataaggatatattcccttgcaagtcctgtggcatctggtatcgg
agtgagcggaatctgcaggcccatttgatgtactactgcagtgggaggcaaagagaagct
gctccggtgtcagaggaaaatgaagacagtgcccatcagatttccagcctgtgccccttc
ccacagtgcaccaagagcttttcaaatgctcgagctctagaaatgcacctgaattcacac
agtggagtgaaaatggaagaattcctgccccctggtgctagtctaaaatgcaccgtctgt
agctacactgctgattctgtgatcaactttcaccaacacctgttctcccatctcactcaa
gctgccttccgatgtaatcactgccatttcggcttccagactcagagggagttattgcag
caccaggagctccatgtccctagcggcaaacttcccagagaaagtgacatggaacactct
ccaagtggaaccgaagacagcttacagccagccacagacttattgaccagaagcgaactt
ccccagagccaaaaggccatgcagactaaagatgcgagctctgacacagagctggacaag
tgtgagaaaaagactcagctctttctcacgaaccagagaccagagatacagcctacaaca
aataaacaaagcttttcttacacaaaaataaagtctgagccctctagcccaagacttgcc
tcatctccagttcagcctaatatggggccttctttccctgtgggccctttcctatctcag
ttttctttcccccaagatatcaccatggtccctcaagcttcagagatcttagccaagatg
tctgaactggtgcatcggcgactgaggcatggcagtagtagctaccctcccgtcatttac
agccctttgatgcccaagggggctacttgttttgagtgtaacataacattcaataatttg
gataattatctagtgcacaaaaagcattattgcagcagccgatggcagcagatggctaag
tccccagagttccctagtgtgtcagaaaagatgcctgaagctttgagtcccaacactggc
caaacctccataaaccttctcaacccagctgctcattctgctgatcctgagaatccactt
cttcaaacatcttgcatcaattcttccactgtcttagatttaattgggccaaatgggaag
ggccatgacaaggacttttccactcaaactaagaagctctccacctccagtaacaatgat
gacaaaattaatggaaaacctgttgatgtgaaaaatcccagtgtccccttagtggatggg
gaaagtgacccaaataagactacctgtgaagcttgcaacattaccttcagccggcacgaa
acatacatggtccacaaacagtattactgtgctacacgccacgaccctccactaaagagg
tctgcttccaacaaagtgcctgccatgcagagaaccatgcgcacacgcaagcgcagaaag
atgtatgagatgtgcctacctgagcaggaacaaaggcctccactggttcagcagagattt
cttgatatagccaacctcaataatccttgtacctccactcaagaacccacagaagggcta
ggagagtgctaccacccaagatgtgatatctttccaggaattgtctctaagcacttggaa
acttctctgacgatcaacaagtgtgttccagtttccaaatgtgacactactcattccaat
gtttcctgcctagagatggacgtgcccatagatctcagcaaaaagtgtttatctcagtct
gagcggacgaccacgtctcccaaaaggctgctggactatcacgagtgcactgtgtgcaag
atcagtttcaataaggtagaaaactatctggcccacaagcagaatttctgcccggttact
gcacatcagcgtaatgacctgggtcaactggacagcaaagtgtttccgaatccagaaagc
gaacgaaacagccctgatgtcagctacgaaagaagcataataaaatgtgagaaaaatggg
aatttgaagcagccttcccccaatggaaacttattttcatcccacctagcaaccctgcaa
ggcttgaaggtcttcagtgaagccgctcagctcattgctacaaaagaagaaaacagacat
ttgtttcttccacaatgcctttaccctggagcaataaagaaagcaaaaggagccgaccag
ctttctccatattatggaatcaagccaagtgattatatttctggttctcttgtcatccat
aacactgacatcgagcaaagcacaaatgcagaaaatgaatctcctaaaggccaggcttcc
tcaaatgggtgtgctgcgctgaagaaagattctctgccattgttgcccaaaaatcgagga
atggtaatagtgaatggtggactgaaacaagatgagagacctgctgccaacccacagcaa
gagaacatttcccagaatcctcagcatgaagatgaccacaaatctccctcgtggatctct
gagaacccattagctgccaatgagaatgtctcaccaggaattccctcagcagaggaacag
ttgtctagtatagcaaaaggtgtgaatggttccagccaggctccaaccagtgggaaatat
tgccggctgtgtgatatccagttcaacaacctttcaaactttataactcacaagaagttt
tattgctcatcacatgcagcggaacatgtcaaatga

DBGET integrated database retrieval system