KEGG   Pongo abelii (Sumatran orangutan): 100445187
Entry
100445187         CDS       T01416                                 

Gene name
MARCKS
Definition
(RefSeq) myristoylated alanine-rich C-kinase substrate
  KO
K12561  myristoylated alanine-rich C-kinase substrate
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04666  Fc gamma R-mediated phagocytosis
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100445187 (MARCKS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100445187 (MARCKS)
SSDB
Motif
Pfam: MARCKS
Other DBs
NCBI-GeneID: 100445187
NCBI-ProteinID: XP_002817310
Ensembl: ENSPPYG00000016938
UniProt: H2PK38 A0A663DHI7
LinkDB
Position
6
AA seq 331 aa
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQA
NGSAPAADKEEPAAAGSGAASPSAAEKDEPAAAAPEAGASPVEKEAPAEGEAAEPGSPTA
AEGEAASAASSTSSPKAEDGATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEG
GEAEAPAAEGGKDEAAGGAAAAAAEAGAASGEQAAAPGEEAAEGEEGAAGGDPQEAKPEE
AAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACEAPSAAGPGAPPEQEAAPAEEP
AAAAASSACAATSQEAQPECSPEAPPAEAAE
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggtgcccagttctccaagaccgcagcgaagggagaagccgccgcggagaggcccggg
gaggcggctgtggcctcgtcgccttccaaagcgaacgggcaggagaatggccacgtgaag
gtaaacggcgacgcttcgcccgcggccgccgagtcgggcgccaaggaggagctgcaagcc
aacggcagcgccccggccgcagacaaggaggagcccgcggccgccgggagcggggcggcg
tcgccctccgcggccgagaaagatgagccggccgccgccgcccccgaggcgggggccagc
ccggtagagaaggaggcccccgcggaaggcgaggctgccgagcctggctcgcccacggcc
gcggagggagaggccgcgtcggccgcctcctcgacgtcttcgcccaaggccgaggacggg
gccacgccctcgcccagcaacgagaccccgaaaaaaaaaaagaagcgcttttccttcaag
aagtctttcaagctgagcggtttctccttcaagaagaacaagaaggaggctggagagggc
ggtgaggctgaggcgcctgctgccgaaggcggcaaggacgaggccgccgggggcgcagct
gcggccgccgccgaggcgggcgcggcctccggggagcaggcagcggcgccgggcgaggag
gcggcagagggcgaggagggggcggcgggtggcgacccgcaggaggccaagcccgaggag
gccgctgtcgcgccagagaagccgcccgccagcgacgagaccaaggctgccgaggagccc
agcaaggtggaggagaagaaggccgaggaggccggggccagcgccgctgcctgcgaggcc
ccctcggccgccgggcctggcgcgcccccagagcaggaggccgcccccgcggaggagccc
gcggccgccgccgcctcgtcagcctgcgcagccacctcacaggaggcccagcccgagtgc
agtccagaagcccccccagcggaggcggcagagtaa

DBGET integrated database retrieval system