KEGG   Pongo abelii (Sumatran orangutan): 100445305
Entry
100445305         CDS       T01416                                 

Gene name
CHKB
Definition
(RefSeq) choline/ethanolamine kinase
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon05231  Choline metabolism in cancer
Module
pon_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
pon_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100445305 (CHKB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100445305 (CHKB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100445305 (CHKB)
    2.7.1.82  ethanolamine kinase
     100445305 (CHKB)
SSDB
Motif
Pfam: Choline_kinase APH EcKinase Pkinase_fungal
Other DBs
NCBI-GeneID: 100445305
NCBI-ProteinID: XP_003779632
LinkDB
Position
22
AA seq 395 aa
MAAEGTAVAGSGVVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCQEYLGGA
WRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH
NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP
TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLAEVSWYALASHFFWGLWSILQ
ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcggccgaggggacagctgtggccggaagcggggttgttggcggctgcctggccaaa
gacggcttgcagcagtctaagtgcccggacactaccccaaaacggcggcgcgcctcgtcg
ctgtcgcgtgacgccgagcgccgagcctaccaatggtgccaggagtacttgggcggggcc
tggcgccgagtgcagcccgaggagctgagggtttaccccgtgagcggaggcctcagcaac
ctgctcttccgctgctcgctcccggaccacctgcccagcgttggcgaggagccccgggag
gtgctgctgcggctgtacggagccatcctgcagggcgtggactccctggtgctagaaagc
gtgatgtttgccatccttgcggagcggtcgctggggccccagctgtacggagtcttccca
gagggccggctggaacagtacatcccaagccggccattgaaaactcaagagcttcgagag
ccagtgttgtcagcagccattgccacgaagatggcgcaatttcatggcatggagatgcct
ttcaccaaggagccccactggctgtttgggaccatggagcggtacctaaaacagatccag
gacctgcccccaactggcctccctgaaatgaacctgctggagatgtacagcctgaaggat
gagatgggcaacctcaggaagttactagagtctaccccatcgccagtcgtcttctgccac
aatgacatccaggaagggaacatcttgctgctctcagagccagaaaatgctgacagcctc
atgctggtggacttcgagtacagcagttataactataggggctttgacattgggaaccat
ttttgtgagtgggtttatgattatactcacgaggaatggcctttctacaaagcaaggccc
acagactaccccactcaagaacagcagctgcattttattcgccattacctggcagaggca
aagaaaggtgagaccctctcccaagaggagcagagaaaactggaagaagatttgctggca
gaagtcagttggtatgctctggcatcccatttcttctggggtctgtggtccatcctccag
gcatccatgtccaccatagaatttggttacttggactatgcccagtctcggttccagttc
tacttccagcagaaggggcagctgaccagtgtccactcctcatcctga

KEGG   Pongo abelii (Sumatran orangutan): 100451626
Entry
100451626         CDS       T01416                                 

Gene name
CHKA
Definition
(RefSeq) choline kinase alpha isoform X1
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon05231  Choline metabolism in cancer
Module
pon_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
pon_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100451626 (CHKA)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100451626 (CHKA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100451626 (CHKA)
    2.7.1.82  ethanolamine kinase
     100451626 (CHKA)
SSDB
Motif
Pfam: Choline_kinase APH EcKinase Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 100451626
NCBI-ProteinID: XP_024111308
LinkDB
Position
11
AA seq 453 aa
MKTKFCTGGEAEPSPLGLLLSCGSGSAAPPPGVGQQRDAASDLESKQLGGQQPPLALPQP
PPPPPLPQPPSPPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGLSNML
FQCSLPDTTATLGDEPRKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLESVMF
AILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKMPFNK
EPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPVVFCH
NDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFRA
NIRKYPTNKQQLHFISSYLPAFQNDFENLNTEEKSIIEEEMLLEVNRFALASHFLWGLWS
IVQAKISSIEFGYMDYAQARFDAYFHQKRKLGV
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaaaaccaagttctgcaccgggggcgaggcggagccctcgcccctggggctgctgctt
agctgcggtagcggcagcgcggccccgccgcccggcgtggggcagcagcgcgacgccgcc
agcgacctcgagtcgaagcagctgggcggccaacagccgccgctcgcgctgccccagccc
ccgccgccgccgccgctgccccagcccccgtcgccgccgccggcagacgagcagccggag
ccccggacgcggcgcagggcctatctgtggtgcaaggagttcctgcccggcgcctggcgg
ggcctccgcgaggacgagttccacatcagtgtcatcagaggtggccttagcaacatgctg
ttccagtgctccctgcctgacaccacagccacccttggcgatgagcctcggaaagtgctc
ctgcggctgtatggagcaattttgcagatgaggtcctgtaataaagagggatccgaacaa
gctcagaaagaaaatgaatttcaaggggccgaggccatggttctggagagcgttatgttt
gccattctcgcagagaggtcacttgggccaaaactctatggcatctttccccaaggccga
ctggagcagttcatcccgagccggcgattagatacagaagaattaagtttgccagatatt
tctgcagaaatcgctgagaaaatggctacgtttcatggtatgaaaatgccattcaataag
gaaccaaaatggctttttggcacaatggaaaagtatctaaaggaagtgctgagaattaaa
tttactgaggaatccagaattaaaaagctccacaaattgctcagttacaatctgcccttg
gaactggaaaacctgagatcattgcttgaatctactccatctccagttgtattttgtcat
aatgactgtcaagaaggtaatatcttgttgctggaaggccgagagaattctgaaaaacag
aaactgatgctcattgatttcgaatacagcagttacaattacaggggattcgacattgga
aatcacttctgtgagtggatgtatgattatagctatgaaaaatacccttttttcagagca
aacatccggaagtatcccaccaacaaacaacagctccattttatttccagttacttgcct
gcattccaaaatgactttgaaaacctcaatactgaagaaaaatccattatagaagaagaa
atgttgcttgaagtcaataggtttgcccttgcatctcatttcctctggggactttggtcc
attgtacaagccaagatttcatctattgaatttgggtacatggactacgcccaagcaagg
tttgatgcctatttccaccagaagaggaagcttggggtgtga

DBGET integrated database retrieval system