KEGG   Pongo abelii (Sumatran orangutan): 100445606
Entry
100445606         CDS       T01416                                 

Gene name
CDCA5
Definition
(RefSeq) sororin
  KO
K17390  sororin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100445606 (CDCA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100445606 (CDCA5)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    100445606 (CDCA5)
SSDB
Motif
Pfam: Sororin
Other DBs
NCBI-GeneID: 100445606
NCBI-ProteinID: XP_024111473
LinkDB
Position
11
AA seq 252 aa
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAIRKPIVL
KRIVAHAVEVPAVQSPRRSPRIAFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNP
EAESSSKEEELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSFFGFEGLLGAEDLSGV
SPVVCSKFTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAE
FEAAEQFDLLVE
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctgggaggcgaacgcggtccggaggagccgctcagcgctccgggccaagggcccca
tctcccactaagcctctgcggaggtcccagcggaaatcaggctctgaactcccaagcatc
ctccctgaaatctggccgaagacacccagtgcggctgcaatcagaaagcccatcgtctta
aagaggatcgtggcccatgctgtagaggtcccagctgtccaatcacctcgcaggagccct
aggattgcctttttcttggagaaagaaaacgagccccctggcagggagcttactaaggag
gaccttttcaagacacacagcgtccctgccacccccaccagcactcctgtgccgaaccct
gaggccgagtccagctccaaggaagaagagctggatgccagagacttggaaatgtctaag
aaagtcaggcgttcctacagccggctagagaccctgggctctgcctctacctccacccca
ggccgccggtccttctttggcttcgaggggctgctgggggcagaagacttgtccggagtc
tcgccagtggtgtgctccaaattcaccgaggtccccagggtctgtgcaaagccctgggcc
ccagacatgactctccctggaatctccccaccacccgagaaacagaaacgtaagaagaag
aagatgccagagatcttgaaaacggagctggatgagtgggctgcggccatgaatgccgag
tttgaagctgctgagcagtttgatctcctggttgaatga

DBGET integrated database retrieval system