KEGG   Pongo abelii (Sumatran orangutan): 100445634
Entry
100445634         CDS       T01416                                 

Gene name
CREBBP
Definition
(RefSeq) LOW QUALITY PROTEIN: CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04310  Wnt signaling pathway
pon04330  Notch signaling pathway
pon04350  TGF-beta signaling pathway
pon04520  Adherens junction
pon04630  JAK-STAT signaling pathway
pon04720  Long-term potentiation
pon04916  Melanogenesis
pon04919  Thyroid hormone signaling pathway
pon04922  Glucagon signaling pathway
pon04935  Growth hormone synthesis, secretion and action
pon05016  Huntington disease
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100445634 (CREBBP)
   04330 Notch signaling pathway
    100445634 (CREBBP)
   04350 TGF-beta signaling pathway
    100445634 (CREBBP)
   04630 JAK-STAT signaling pathway
    100445634 (CREBBP)
   04066 HIF-1 signaling pathway
    100445634 (CREBBP)
   04068 FoxO signaling pathway
    100445634 (CREBBP)
   04024 cAMP signaling pathway
    100445634 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100445634 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100445634 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100445634 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    100445634 (CREBBP)
   04919 Thyroid hormone signaling pathway
    100445634 (CREBBP)
   04916 Melanogenesis
    100445634 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    100445634 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100445634 (CREBBP)
   05206 MicroRNAs in cancer
    100445634 (CREBBP)
   05203 Viral carcinogenesis
    100445634 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100445634 (CREBBP)
   05215 Prostate cancer
    100445634 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100445634 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100445634 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100445634 (CREBBP)
   05161 Hepatitis B
    100445634 (CREBBP)
   05164 Influenza A
    100445634 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100445634 (CREBBP)
   05165 Human papillomavirus infection
    100445634 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100445634 (CREBBP)
   03036 Chromosome and associated proteins [BR:pon03036]
    100445634 (CREBBP)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100445634 (CREBBP)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100445634 (CREBBP)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100445634 (CREBBP)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100445634 (CREBBP)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100445634 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100445634
NCBI-ProteinID: XP_002826106
Ensembl: ENSPPYG00000007051
LinkDB
Position
16
AA seq 2439 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGK
SPLSQGDSSAPSLPKQTASTSGPTPPASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLA
ETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
QSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMSSVPGMAISPSRMPQPPNMMGAHT
NNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQTEDTEPDPGESKGEPRSE
MMEEDLQGASQVKEETDTAEQKSEPMEVDEKKPEVKVEVKEEEESSTNGTASQSTSPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDSCLKKTGRPRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAH
KMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPTQPQPSPVSMSPAG
FPSVARTQPPTTVSTGKPTSQVPXPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNG
MPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVI
SMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQA
MGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQGSAGMAG
GMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLGADS
TPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQV
RSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNP
EQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7320 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaaagagccaaactcagctcgccc
ggtttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatacccaatggaggagaattaggccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctacgaggaggcagcggctct
agtatcaacccaggaataggaaatgtgagcgccagcagccccgtgcagcagggcctgggt
ggccaggctcaagggcagccgaacagtgcgaacatggccagcctcagtgccatgggcaag
agccctctgagccagggagattcttcagcccccagcctgcccaaacagacagccagcacc
tctgggcccaccccccctgcctcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggcgactagcagccctgccacgtcacagactggacctggtatctgcatgaatgctaac
tttaaccagacccacccaggcctcctcaatagtaactctggccatagcttaattaatcag
gcttcacaagggcaggcgcaagtcatgaatggatctcttggggctgctggcagaggaagg
ggagctggaatgccgtaccctactccagccatgcagggcgccacaagcagtgtgctggct
gagaccctaacgcaggtttccccgcaaatgactggtcacgcgggactgaacaccgcacag
gcaggaggcatggctaagatgggaataactgggaacacaagtccatttggacagcccttt
agtcaagctggagggcagccaatgggagccactggagtgaacccccagttagccagcaaa
cagagcatggtcaacagtttgcccaccttccctacagacatcaagaatacttcagtcacc
aacgtgccaaatatgtctcagatgcaaacatcagtgggaattgtacccacacaagcaatt
gcaacaggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttcta
ctgcttcatgctcataagtgtcagagacgagagcaagcaaacggagaggttcgggcctgc
tcgctcccacattgtcgaaccatgaaaaacgttttgaatcacatgacgcattgtcaggct
gggaaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacacaattggttctgtt
ggcacagggcaacagaatgctacttctttaagtaacccaaatcccatagaccccagctcc
atgcagcgagcctatgctgctctcggactcccctacatgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaacccaccagcagatgaggact
ctcaaccccctgggaaataatccaatgaacattccagcaggaggaataacaacagatcag
cagcccccaaacttgatttcagaatcagctcttccgacttccctgggggccacaaaccca
ctgatgaacgatggctccaactctggtaacattggaaccctcagcactataccaacagca
gctcctccttctagcaccggtgtaaggaaaggctggcacgaacatgtcactcaggacctg
cggagccatctagtgcataaactcgtccaagccatcttcccaacacctgatcccgcagct
ctaaaggatcgccgcatggaaaacctggtagcctatgctaagaaagtggaaggggacatg
tacgagtctgccaacagcagggatgaatattatcacttattagcagagaaaatctacaag
atacaaaaagaactagaagaaaaacggaggtcgcgtttacataaacaaggcatcttgggg
aaccagccagccttaccagccccgggggctcagccacctgtgattccacaggcacaacct
gtgagacctccaaatggacccctgtccctgccagtgaatcgcatgcaagtttctcaaggg
atgaattcatttaaccccatgtccttggggaacgtccagttgccacaagcacccatggga
cctcgtgcagcctccccaatgaaccactctgtccagatgaacagcatgagctcagtgcca
gggatggccatttctccttcccgaatgcctcagcctccgaacatgatgggcgcacacacc
aacaacatgatggcccaggcacctgctcagagccagtttctgccacagaaccagttccca
tcatccagcggggcgatgagtgtgggcatggggcagccgccagcccaaacaggcgtgtca
cagggacaggtgcctggtgctgctcttcctaaccctctcaacatgctggggcctcaggcc
agccagctgccttgccctccagtgacacagtcaccactgcacccaacaccgcctcctgct
tccacggctgctggcatgccatctctccagcacacgacaccacctgggatgactcctccc
cagccagcagctcccactcagccatcaactcctgtgtcgtcttccgggcagactcccacc
ccgactcctggctcagtgcccagtgctacccaaacccagagcacccctacagtccaagca
gcagcccaggcccaggtgaccccgcagcctcaaaccccagttcagcccccgtctgtggct
acccctcagtcatcacagcaacagccgacgcccgtgcacgcccagcctcctggcacaccg
ctttcccaggcagcagccagcattgataacagagtccctaccccctcctcggtggccagc
gcagaaaccaattcccagcagccgggacctgacgtacctgtgctggaaatgaagacggag
acccagacagaggacactgagcccgatcctggtgaatccaaaggggagcccaggtctgag
atgatggaggaggatttgcaaggagcttcccaagttaaagaagaaacagacacagcagag
cagaaatcagaaccaatggaagtggatgaaaagaaacctgaagtgaaagtagaagttaaa
gaggaagaagagagtagcactaacggcacagcctctcagtcaacatctccttcgcaacca
cgcaaaaaaatctttaaaccagaggagttacgccaggccctcatgccaaccctagaagca
ctgtatcgacaggacccagagtcgttacctttccggcagcctgtagatccccagctcctc
ggaattccagactattttgacatcgtaaagaatcccatggacctctccaccatcaagcgg
aagctggacacagggcaataccaagagccctggcagtatgtggacgacgtctggctcatg
ttcaacaatgcctggctctataatcgcaagacatcccgagtctataagttttgcagtaag
cttgcagaggtctttgagcaggaaattgaccctgtcatgcagtcccttggatattgctgt
ggacgcaagtatgagttttccccgcagactttgtgctgctatgggaagcagctgtgtacc
attcctcgcgatgctgcctactacagctatcagaataggtatcatttctgtgagaagtgt
ttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcacagccccagacg
acaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagaccccgaacctttc
gttgattgcaaggagtgtggccggaagatgcatcagatttgcgttctgcactatgacatc
atttggccttcaggttttgtgtgcgacagctgcttgaagaaaactggcagacctcgaaaa
gaaaacaaattcagtgctaagaggctgcagaccacaagactgggaaaccacttggaagac
cgagtgaacaaatttttgcggcgacagaatcaccctgaagccggggaggtttttgtccga
gtggtggccagctcagacaagacggtggaggtcaagcccgggatgaagtcacggtttgtg
gattctggggaaatgtctgaatctttcccatatcgaaccaaagctctgtttgcttttgag
gaaattgacggcgtggatgtctgcttttttggaatgcacgtccaagaatatggctctgat
tgcccccctccaaacacaaggcgtgtgtacatttcttatctggatagtattcatttcttc
cggccacgttgcctccgcacagccgtttaccatgagatccttattggatatttagagtat
gtgaagaaattggggtacgtgacagggcacatctgggcctgtcctccaagtgaaggagat
gattacatcttccattgccacccacctgatcaaaaaatacccaagccaaaacgactgcag
gagtggtacaaaaagatgctggacaaggcgtttgcagagcggatcattcatgactacaag
gatattttcaaacaagcaactgaagacaggctcaccagtgccaaggaactgccctatttt
gaaggtgatttctggcccaatgtgttagaagagagcattaaggaactagaacaagaagaa
gaggagaggaaaaaggaagagagcactgcagccagtgaaactactgagggcagtcagggc
gacagcaagaatgccaagaagaagaacaacaagaaaaccaacaagaacaaaagcagcatc
agccgcgccaacaagaagaagcccagcatgcccaacgtgtccaatgacctatcccagaag
ctgtatgccaccatggagaagcacaaggaggtcttcttcgtgatccacctgcacgctggg
cctgtcatcaacaccctgccccccatcgtcgaccccgaccccctgctcagctgtgacctc
atggatgggcgcgacgccttcctcacactcgccagagacaagcactgggagttctcctcc
ttgcgccgctccaagtggtccacgctctgcatgctggtggagctgcacacccagggccag
gaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagacgcgctggcactgc
actgtgtgcgaggactacgacctctgcatcaactgctataacacgaagagccatgcccat
aagatggtgaagtgggggctgggcctggatgacgagggcagcagccagggcgagccacag
tcaaagagcccccaggagtcacgacggctgagcatccagcgctgcatccagtcgctggtg
cacgcgtgccagtgccgcaacgccaactgctcgctgccatcctgccagaagatgaagcgg
gtggtgcagcacaccaagggctgcaaacggaagaccaatgggggctgcccggtgtgcaag
cagctcatcgccctctgctgctaccacgccaagcactgccaagaaaacaaatgccccgtg
cccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcaccgcctgcag
caggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcag
agtctgccttctcctacctcagcaccgcccgggacccccacacagcagcccagcacgccc
cagacgccgcagccccccacccagccccaaccctcacccgtgagcatgtcaccagctggc
ttccccagcgtggcccggactcagccccccaccacggtgtccacagggaagcctaccagc
caggtgccgngccccccacccccggcccagccccctcctgcagcagtggaagcagctcgg
cagatcgaacgtgaggcccagcagcagcagcacctgtaccgggtgaacatcaacaatggc
atgcccccaggacgcacgggcatggggaccccggggagccagatggcccccgtgagcctg
aatgtgccccgacccaaccaggtgagcgggccggtcatgcccagcatgcctcccgggcag
tggcagcaggcgccccttccccagcagcagcccatgccaggcttgcccaggcctgtgata
tccatgcaggcccaggcggccgtggccgggccccggatgcccagcgtgcagccgcccagg
agcatttcacccagcgctctgcaagacctgctgcggaccctgaagtcgcccagctcccct
cagcagcaacagcaggtgctgaacattctcaaatcaaacccgcagctaatggcagctttc
atcaaacagcgcacagccaagtacgtggccaatcagcccggcatgcagccccagcctggc
ctccagtcccagcccggcatgcaaccccagcctggcatgcaccagcagcccagcctgcag
aacctgaatgccatgcaggctggcgtgccgcggcccggtgtgcctccacagcagcaggca
atgggaggcctgaacccccagggccaggccttgaacatcatgaacccaggacacaacccc
aacatggcgagtatgaatccacagtaccgagaaatgctacggaggcagctgctgcagcag
cagcagcaacaacagcaacaacagcagcagcagcagcaagggagtgccggcatggctggg
ggcatggcggggcacggccagttccagcagcctcaaggacccggaggctacccaccggcc
atgcagcagcagcagcgcatgcagcagcatctccccctccagggcagctccatgggccag
atggcggctcagatgggacagcttggccagatggggcagccggggctgggggcagacagc
acccccaacatccagcaagccctgcagcagcggattctgcagcaacagcagatgaagcag
cagattgggtccccaggccaaccaaaccccatgagcccccagcaacacatgctctcagga
cagccacaggcctcgcatctccctggccagcagatcgccacatcccttagtaaccaggtg
cggtctccagcccctgtccagtctccacggccccagtcccagcctccacattccagcccg
tcaccacggatacagccccagccttcaccacaccacgtctcaccccagactggttccccc
caccccggactcgcagtcaccatggccagctccatagatcagggacacttggggaacccc
gaacagagtgcaatgctcccccagctgaacacccccagcaggagtgcgctgtccagcgaa
ctgtccctggtcggggacaccacgggggacacgctagagaagtttgtggagggcttgtag

KEGG   Pongo abelii (Sumatran orangutan): 100455260
Entry
100455260         CDS       T01416                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300 isoform X2
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04310  Wnt signaling pathway
pon04330  Notch signaling pathway
pon04350  TGF-beta signaling pathway
pon04520  Adherens junction
pon04630  JAK-STAT signaling pathway
pon04720  Long-term potentiation
pon04916  Melanogenesis
pon04919  Thyroid hormone signaling pathway
pon04922  Glucagon signaling pathway
pon04935  Growth hormone synthesis, secretion and action
pon05016  Huntington disease
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100455260 (EP300)
   04330 Notch signaling pathway
    100455260 (EP300)
   04350 TGF-beta signaling pathway
    100455260 (EP300)
   04630 JAK-STAT signaling pathway
    100455260 (EP300)
   04066 HIF-1 signaling pathway
    100455260 (EP300)
   04068 FoxO signaling pathway
    100455260 (EP300)
   04024 cAMP signaling pathway
    100455260 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100455260 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100455260 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100455260 (EP300)
   04935 Growth hormone synthesis, secretion and action
    100455260 (EP300)
   04919 Thyroid hormone signaling pathway
    100455260 (EP300)
   04916 Melanogenesis
    100455260 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    100455260 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100455260 (EP300)
   05206 MicroRNAs in cancer
    100455260 (EP300)
   05203 Viral carcinogenesis
    100455260 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100455260 (EP300)
   05215 Prostate cancer
    100455260 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100455260 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100455260 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100455260 (EP300)
   05161 Hepatitis B
    100455260 (EP300)
   05164 Influenza A
    100455260 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100455260 (EP300)
   05165 Human papillomavirus infection
    100455260 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100455260 (EP300)
   03036 Chromosome and associated proteins [BR:pon03036]
    100455260 (EP300)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100455260 (EP300)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100455260 (EP300)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100455260 (EP300)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100455260 (EP300)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100455260 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100455260
NCBI-ProteinID: XP_009232690
Ensembl: ENSPPYG00000011862
LinkDB
Position
22
AA seq 2382 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGSGQVMASQAQQNSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPAQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLPPFAMDKKTVPGGGMP
NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSTPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AAGMVPVSMNPGPNMGQPQPGMTSSLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALN
PPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSP
IMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPNIGAQQPPATTIPAPVPTP
PAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPT
PTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIPEKQPSQEVKMEAKMEVDQ
PEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKK
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKL
DTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGR
KLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTI
NKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKEN
KFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDS
GEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRP
KCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEW
YKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEE
RKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYA
TMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRR
AQWSTICMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKME
KLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQ
HTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQ
MLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPATPQTPQPTSQPQPTPPNSMPPY
LPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQ
IFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWGQGGLPQPQQL
QSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQ
QQQVLSILHANPQLLAAFIKQRAAKYANSNSQPIPGQPGLQPPTMPGQQGVHSNPAMQNM
NPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQ
QQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAE
AGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQP
VPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSM
LSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
NT seq 7149 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctatttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggcatagtacaagatgcagcttctaaacataaacag
ctgtcagaattgctgcgatctggtagttcccctaacctcaatatgggagttggtggctca
ggtcaagtcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatgacacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctgcgcagtcaacaggtatgatgaacagtccagtaaatcag
cctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggctgca
ggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagcaggccga
gggcgacagaatatgcagtacccaaacccaggcatgggaagtgctggcaacttactgact
gagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggcccccag
cctcttaagatgggaatgatgaacaaccccaatccttatggttcaccatatactcagaat
cctggacagcagattggtgccagtggccttggtctccagattcagacaaaaactgtacta
tcaaataacttacctccatttgctatggacaaaaagacagttcctggtggaggaatgccc
aacatgggtcaacagccagccccgcaggtccagcagccaggcctggtcactccagttgcc
caagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccagcag
caacttgttctccttttgcatgctcacaagtgccagcgccgggaacaggccaatggggaa
gtgaggcagtgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccacatgaca
cactgccagtcaggcaagtcttgccaagtggcacactgtgcatcttctcgacaaatcatt
tcacactggaagaattgtacaagacatgattgtcctgtgtgtctccccctcaaaaatgct
ggtgataagagaaatcaacagccaattttgactggagcacccgttggacttggaaatcct
agctctctaggggtgggtcaacagtctacccccaacctaagcactgttagtcagattgat
cccagctctatagaaagagcctatgcagctcttggactaccctatcaagtaaatcagatg
ccgacacaaccccaggtgcaagcaaagaaccagcagaatcagcagcctgggcagtctccc
caaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggtgta
ggagttcaaacgccgagtcttctttctgactcaatgttgcattcagccataaattctcaa
aacccaatgatgagtgaaaatgccagtgtgccctccctgggtcctatgccaacagcagct
caaccatccactactggaattcggaaacagtggcatgaagatattactcaggatcttcga
aatcatcttgttcacaaactcgtccaagccatatttcctacaccggatcctgctgcttta
aaagacagacggatggaaaacctagttgcatatgctcggaaagtcgaaggggacatgtat
gaatctgcaaacaatcgagcggaatactaccaccttctagctgagaaaatctataagatc
cagaaagaactagaagaaaaacgaaggaccagactacagaagcagaacatgctaccaaat
gctgcaggcatggttccagtttccatgaatccggggcctaacatgggacagccgcaacca
ggaatgacttctagtttgaatcaatttggccagatgagcatggcccagccccctattgta
ccccggcaaacccctcctcttcagcaccatggacagttggctcaacctggagctctcaac
ccgcctatgggttatgggcctcgtatgcaacagccttccaaccagggccagttccttcct
cagactcagttcccatcacagggaatgaatgtaacaaatatccctttggctccgtccagc
ggtcaagctccagtgtctcaagcacaaatgtctagttcttcctgcccggtgaactctcct
ataatgcctccagggtctcaggggagccacattcactgtccccagcttcctcaaccagct
ctgcatcagaattcaccctcgcctgtacctagtcgtacccccacccctcaccatactccc
ccaaacataggggctcagcagccaccagcaacaacaattccagcccctgttcctacacct
cctgctatgccacctgggccacagtcccaggctctacatccccctccaaggcagacacct
acaccaccaacaacacaacttccccaacaagtgcagccttcacttcctgctgcaccttct
gctgaccagccccagcagcagcctcgctcacagcagagcacagcagcgtctgttcctacc
ccaacagcaccgttgcttcctccacagcctgcaactccactttcccagccagctgtaagc
attgaaggacaggtatcaaaccctccatctactagtagcacagaagtgaattctcaggcc
attcctgagaagcagccttcccaggaagtgaagatggaggccaaaatggaagtggatcaa
ccagaaccagcagatactcagccggaggatatttcagagtctaaagtggaagactgtaaa
atggaatctaccgaaacagaagagagaagcactgagttaaaaactgaaataaaagaggag
gaagaccagccaagtacttcagctacccagtcatctccggctccaggacagtcaaagaaa
aagattttcaaaccagaagaactacgacaggcactgatgccaacattggaggcactttac
cgtcaggatccagaatcccttccctttcgtcaacctgtggaccctcagcttttaggaatc
cctgattactttgatattgtgaagagccccatggatctttctaccattaagaggaagtta
gacactggacagtatcaggagccctggcaatatgtcgatgatatttggctgatgttcaat
aatgcctggttatataaccggaaaacatcacgggtatacaaatactgctccaagctctct
gaggtctttgaacaagaaattgacccagtgatgcaaagccttggatactgttgtggcaga
aagttggagttctctccacagacactgtgttgctacggcaaacagttgtgcacaatacct
cgtgatgccacttattacagttaccagaacaggtatcatttctgtgagaagtgtttcaat
gagatccaaggggagagcgtttctttgggggatgacccttcccagcctcaaactacaata
aataaagaacaattttccaagagaaaaaatgacacactggatcctgaactgtttgttgaa
tgtacagagtgcggaagaaagatgcatcagatctgtgtccttcaccatgagatcatctgg
cccgctggattcgtctgtgatggctgtttaaagaaaagtgcacgaactaggaaagaaaat
aagttttctgctaaaaggttgccatctaccagacttggcacctttctagagaatcgtgtg
aatgactttctgaggcgacagaatcaccctgagtcaggagaggtcactgttagagtagtt
catgcttctgacaaaaccgtggaagtaaaaccaggcatgaaagcaaggtttgtggacagt
ggagagatggcagaatcctttccgtaccgaaccaaagccctctttgcctttgaagaaatt
gatggcgttgacctatgcttctttggcatgcatgttcaagagtatggctctgactgccct
ccacccaaccagaggagagtatacatatcttacctcgatagtgttcatttcttccgtcct
aaatgcttgaggactgcagtctatcatgaaatcctaattggttatttagaatatgtcaag
aaattaggttacacaacagggcatatttgggcatgtccaccaagtgagggagatgattat
atcttccattgccatcctcctgaccagaagatacccaagcccaagcgactgcaggaatgg
tacaaaaaaatgcttgacaaggctgtatcagagcgtattgtccatgactacaaggatatt
tttaaacaagctactgaagatagattaacaagtgcaaaggaattgccttactttgagggt
gatttctggcccaatgttctggaagaaagcattaaggaactggaacaggaggaagaagag
agaaaacgagaggaaaacaccagcaatgaaagcacagatgtgaccaagggagacagcaaa
aatgctaaaaagaagaataataagaaaaccagcaaaaataagagcagcctgagtaggggc
aacaagaagaaacccgggatgcccaatgtatctaacgacctctcacagaaactatatgcc
actatggagaagcataaagaggtcttctttgtgatccgcctcattgctggccctgccgcc
aactccctgcctcccattgttgatcctgaccctctcattccctgcgatctgatggatggt
cgggatgcctttctcacgctggcaagggacaagcacctggagttctcttcactccgaaga
gcccagtggtccaccatatgcatgctggtggagctgcacacacagagccaggaccgcttt
gtctacacctgcaatgaatgcaagcaccatgtggagacacgttggcactgtactgtctgt
gaggattatgacttgtgtatcacctgctataacactaaaaaccatgaccacaaaatggag
aaactaggtcttggcttagatgatgagagcaacaaccagcaggctgcagccacccagagc
ccaggcgattctcgccgcctgagtatccagcgctgcatccagtctctggtccatgcttgc
cagtgtcggaatgccaattgctcactgccatcctgccagaagatgaagcgggttgtgcag
cataccaagggttgcaaacggaaaaccaatggcgggtgccccatctgcaagcagctcatt
gccctctgctgctaccatgccaagcactgccaggagaacaaatgcccggtgccgttctgc
ctaaacatcaagcagaagctccggcagcaacaactgcagcaccgattacagcaggcccaa
atgcttcgcaggaggatggccagcatgcagcggactggtgtggttgggcagcaacagggc
ctcccttccccaactcctgccactccaacgacaccaactggccaacagccagccaccccg
cagaccccccagcccacttctcagcctcagcctacccctcccaatagcatgccaccctac
ttgcccaggactcaagctgctggacctgtgtcccagggtaaggcagcaggccaggtgacc
cctccaacccctcctcagactgctcagccaccccttccagggccgccacctgcagcagtg
gaaatggcaatgcagattcagagagcagcagagacgcagcgccagatggcccacgtgcaa
atttttcaaaggccaatccaacaccagatgcccccgatgactcccatggcccccatgggt
atgaacccacctcccatgaccagaggtcccagtgggcatttggagccagggatgggaccg
acagggatgcagcaacagccaccctggggccaaggaggattgcctcagccccagcaacta
cagtctgggatgccaaggccagccatgatgtcagtggcccagcatggtcaacccttgaac
atggctccacaaccaggattgggccaggtaggtgtgagcccactcaaaccaggcactgtg
tctcaacaagccttacaaaaccttttgcggactctcaggtctcccagctctcccctacag
cagcaacaggtgcttagtatccttcacgccaacccccagctgttggctgcattcatcaag
cagcgggctgccaaatatgccaactctaattcacaacccatcccggggcagccagggctg
cagccacctaccatgccaggtcagcagggggtccactccaacccagccatgcagaacatg
aatccaatgcaggcgggcgtccagagggctggcctgccccagcagcaaccacagcagcaa
ctccagccacccatgggagggatgagcccccaggctcagcagatgaacatgaaccacaac
accatgccttcacaattccgagacatcttgagacgacagcaaatgatgcaacagcagcag
caacagggagcagggccaggaataggccctggaatggccaaccataaccagttccagcaa
ccccaaggagttggctacccaccacagcagcagcagcagcggatgcagcatcacatgcaa
cagatgcaacaaggaaatatgggacagatgggccagcttccccaggccttgggagcagag
gcaggtgccagtctacaggcctatcagcagcgactccttcagcaacaaatggggtctcct
gctcagcccaaccccatgagcccccagcagcatatgctcccaaatcaggcccagtctcca
cacctacaaggccagcagatccctaattcactctccaatcaagtgcgctctccccagcct
gtcccttctccacggccacagtcccagcccccccactccagcccttccccaaggatgcag
cctcagccttctccacaccacgtttccccacagacaagttccccacatcctggactggta
gctgcccaggccaaccccatggaacaagggcattttgccagcccggaccagaattcaatg
ctttctcagcttgctagcaatccaggcatggcaaacctccatggtgcaagcgccacggac
ctgggactcagcaccgataactcagacttgaattcaaacctctcacagagtacactagac
atacactag

DBGET integrated database retrieval system