KEGG   Pongo abelii (Sumatran orangutan): 100445635
Entry
100445635         CDS       T01416                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04120  Ubiquitin mediated proteolysis
pon04380  Osteoclast differentiation
pon04630  JAK-STAT signaling pathway
pon04910  Insulin signaling pathway
pon04917  Prolactin signaling pathway
pon04930  Type II diabetes mellitus
pon04935  Growth hormone synthesis, secretion and action
pon05145  Toxoplasmosis
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100445635 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100445635 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100445635 (SOCS1)
   04917 Prolactin signaling pathway
    100445635 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    100445635 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100445635 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100445635 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100445635 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100445635 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100445635 (SOCS1)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100445635 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100445635
NCBI-ProteinID: XP_009248741
Ensembl: ENSPPYG00000007099
UniProt: H2NQ49 A0A663DIK0
LinkDB
Position
16
AA seq 213 aa
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPVPALAPGDTHFRTF
RSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVK
MASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELC
RQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 642 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagccccga
cggcggccagagccttcctcctcttcctcctcctcgcctgcggcccccgcgcgcccgcgg
ccgtgccccgcggtcccggtcccggccctggcccccggcgacacgcacttccgcacattc
cgttcgcacgccgattaccggcgcatcacgcgcgccagcgcgctcctggacgcctgcgga
ttctactgggggcccctgagcgtgcacggggcgcacgagcggctgcgcgccgagcccgtg
ggcaccttcctggtgcgcgacagccgccagcggaactgcttcttcgccctcagcgtgaag
atggcctcgggacccacgagcatccgcgtgcactttcaggccggccgctttcacctggat
ggcagccgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcggcgccg
cgccgcatgctgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgc
cgccagcgcatcgtggccaccgtgggccgcgagaacctggctcgcatccccctcaacccc
gtcctccgcgactacctgagctccttccccttccagatttga

DBGET integrated database retrieval system