KEGG   Pongo abelii (Sumatran orangutan): 100445655
Entry
100445655         CDS       T01416                                 

Gene name
PTPN2
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2 isoform X5
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100445655 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100445655 (PTPN2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100445655 (PTPN2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100445655 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc LAP1C CHASE3 Y_phosphatase3
Other DBs
NCBI-GeneID: 100445655
NCBI-ProteinID: XP_009250495
Ensembl: ENSPPYG00000008983
UniProt: A0A2J8RSH4
LinkDB
Position
18
AA seq 386 aa
MYGKDGKGTNWMDQGDVECRMQEIDDHSRVKLQNAENDYINASLVDIEEAQRSYILTQGP
LPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETGFSVKLLSED
VKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDH
GPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSY
MAIIEGAKCIKGDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKFNGNRIGLEEEKLTGDR
CTGLSSKMQDTVEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPIL
TKMGFMSVILVGAFVGWTLFFQQNAL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgtatggaaaggatggtaaaggcaccaactggatggatcagggagacgtggaatgcaga
atgcaggaaatagatgatcacagtcgtgttaaactgcaaaatgctgagaatgattatatt
aatgccagtttagttgacatagaagaggcacaaaggagttacatcttaacacagggtcca
cttcctaacacatgctgccatttctggcttatggtttggcagcagaagaccaaagcagtt
gtcatgctgaaccgcattgtggagaaagaatcggttaaatgtgcacagtactggccaaca
gatgaccaagagatgctgtttaaagaaacaggattcagtgtgaagctcttgtcagaagat
gtgaagtcgtattatacagtacatctactacaattagaaaatatcaatagtggtgaaacc
agaacaatatctcactttcattatactacctggccagattttggagtccctgaatcacca
gcttcatttctcaatttcttgtttaaagtgagagaatctggctccttgaaccctgaccat
gggcctgcggtgatccactgtagtgcaggcattgggcgctccggcaccttctctctggta
gacacttgtcttgttttgatggaaaaaggagatgatattaacattaaacaggtgttactg
aacatgagaaaataccgaatgggtcttattcagaccccagatcaactgagattctcatac
atggctataatagaaggagcaaaatgtataaagggagattctagtatacagaaacgatgg
aaagaactttctaaggaagacttatctcctgcctttgatcattcaccaaacaaaataatg
actgaaaaattcaatgggaacagaataggtctagaagaagaaaaactgacaggtgaccga
tgtacaggactttcctctaaaatgcaagatacagtggaggagaatagtgagagtgctcta
cggaaacgtattcgagaggacagaaaggccaccacagctcagaaggtgcagcagatgaaa
cagaggctaaatgagaatgaacgaaaaagaaaaaggtggttatattggcaacctattctc
actaagatggggtttatgtcagtcattttggttggcgcttttgttggctggacactgttt
tttcagcaaaatgccctataa

KEGG   Pongo abelii (Sumatran orangutan): 103892420
Entry
103892420         CDS       T01416                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103892420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    103892420
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     103892420
Protein phosphatases and associated proteins [BR:pon01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    103892420
SSDB
Motif
Pfam: Y_phosphatase DSPc IKKbetaNEMObind
Other DBs
NCBI-GeneID: 103892420
NCBI-ProteinID: XP_009247753
LinkDB
Position
14
AA seq 288 aa
MVWQQKTKAVVMLNRIVEKELVKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLL
QLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAG
IGRSGTFSLVDTCLVLMEKGEDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCI
KGDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQD
TVEENSESALRKHIREDRKATTAQKVQQMKQRLNENERKRKRPRLTDT
NT seq 867 nt   +upstreamnt  +downstreamnt
atggtttggcagcagaagaccaaagcagttgtcatgctgaaccgcattgtggagaaagaa
ttggttaaatgtgcacagtattggccaacagatgaccaagagatgctgtttaaagaaaca
ggattcagtgtgaagctcttgtcagaagatgtgaagtcgtattatacagtacatctacta
caattagaaaatatcaatagtggtgaaaccagaacaatatctcactttcattatactacc
tggccagattttggagtccctgaatcaccagcttcatttctcaatttcttgtttaaagtg
agagaatctggctccttgaaccctgaccatgggcctgcggtgatccactgtagtgcaggc
attgggcgctccggcaccttctctctggtagacacttgtcttgttttgatggaaaaagga
gaagatattaacattaaacaggtgttactgaacatgagaaaataccgaatgggtcttatt
cagaccccagatcaactgagattctcatacatggctataatagaaggagcaaaatgtata
aagggagattctagtatacagaaacgatggaaagaactttctaaggaagacttatctcct
gcctttgatcattcaccaaacaaaataatgactgaaaaatacaatgggaacagaataggt
ctagaagaagaaaaactgacaggtgaccgatgtacaggactttcctctaaaatgcaagat
acagtggaggagaacagtgagagtgctctacggaaacatattagagaggacagaaaggcc
accacagctcagaaggtgcagcagatgaaacagaggctaaatgagaatgaacgaaaaaga
aaaaggccaagattgacagacacctaa

DBGET integrated database retrieval system