KEGG   Pongo abelii (Sumatran orangutan): 100445736
Entry
100445736         CDS       T01416                                 

Gene name
DDIT4
Definition
(RefSeq) DNA damage-inducible transcript 4 protein
  KO
K08270  DNA-damage-inducible transcript 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100445736 (DDIT4)
   04150 mTOR signaling pathway
    100445736 (DDIT4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100445736 (DDIT4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100445736 (DDIT4)
SSDB
Motif
Pfam: RTP801_C
Other DBs
NCBI-GeneID: 100445736
NCBI-ProteinID: XP_002820885
Ensembl: ENSPPYG00000002354
UniProt: A0A663DBC8 H2NAL6
LinkDB
Position
10
AA seq 232 aa
MPSLWDRFSSLSTSSSPSSLSRTSTPDRPPRSAWGSAAREEGFDRSTSLESSDCESLDSS
NSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMP
GQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLR
LDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcctagcctttgggaccgcttctcgtcgttgtccacctcctcttcgccctcgtccttg
tcccgaacttccaccccagatcggccgccgcgctcagcctgggggtcggcggcccgggag
gaggggtttgaccgttccacgagcctggagagctcggactgcgagtccctggacagcagc
aacagtggcttcgggccagaggaagacacggcttacctggatggggtgtcgttgcccgac
ttcgagctgctcagtgaccctgaggatgaacacctgtgtgccaacctgatgcagctgctg
caggagagcctggcccaggcgcggctgggctctcgacgccctgcgcgcctgctgatgcct
ggccagctggtaagccaggtgggcaaagaactattgcgcctggcctacagcgagccgtgc
ggcctgcggggggcgctgctggacgtctgcgtggagcagggcaagagctgccacagcgtg
ggccagctggcactcgaccccagcctggtgcccaccttccagctgaccctcgtgctgcgc
ctggactcacgactctggcccaagatccaggggctgtttagctctgccaactctcccttc
ctccctggcttcagccagtccctgacgctgagcactggcttccgagtcatcaagaagaag
ctgtacagctcggaacagctgctcattgaggagtgttga

DBGET integrated database retrieval system