KEGG   Pongo abelii (Sumatran orangutan): 100445807
Entry
100445807         CDS       T01416                                 

Gene name
BTC
Definition
(RefSeq) probetacellulin isoform X1
  KO
K09783  betacellulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100445807 (BTC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100445807 (BTC)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100445807 (BTC)
SSDB
Motif
Pfam: EGF Shisa Cadherin_C_2 Vpu Sigma_reg_N EphA2_TM Baculo_11_kDa TMEM52 LapA_dom TMEM154 DUF2663 DAG1 ETRAMP
Other DBs
NCBI-GeneID: 100445807
NCBI-ProteinID: XP_024101976
Ensembl: ENSPPYG00000014839
LinkDB
Position
4
AA seq 178 aa
MDRAARGSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGYPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKHRKRKKKEEEMETLGKDITPINEDIEETNIV
NT seq 537 nt   +upstreamnt  +downstreamnt
atggaccgggccgccaggggcagcggcgccagctccctgccactgctcctggcccttgcc
ctgggtctagtgatcctccactgtgtggtggcagatgggaattccaccagaagtcctgaa
actaatggcctcctctgtggataccctgaggaaaactgtgcagctaccaccacacaatca
aagcggaaaggccacttctctaggtgccccaagcaatacaagcattactgcatcaaaggg
agatgccgcttcgtggtggccgagcagacgccctcctgtgtctgtgatgaaggctacatt
ggagcaaggtgtgagagagttgacttgttttacctaagaggagacagaggacagattctg
gtgatttgtttgatagcagttatggtagtttttattattttggtcatcggtgtctgcaca
tgctgtcatcctcttcggaaacatcgtaaaagaaagaagaaagaagaagaaatggaaact
ctgggtaaagatataactcctatcaatgaagatattgaagagacaaatattgtttaa

DBGET integrated database retrieval system