KEGG   Pongo abelii (Sumatran orangutan): 100446021
Entry
100446021         CDS       T01416                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04218  Cellular senescence
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04540  Gap junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05034  Alcoholism
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100446021 (MAP2K1)
   04012 ErbB signaling pathway
    100446021 (MAP2K1)
   04014 Ras signaling pathway
    100446021 (MAP2K1)
   04015 Rap1 signaling pathway
    100446021 (MAP2K1)
   04370 VEGF signaling pathway
    100446021 (MAP2K1)
   04371 Apelin signaling pathway
    100446021 (MAP2K1)
   04668 TNF signaling pathway
    100446021 (MAP2K1)
   04066 HIF-1 signaling pathway
    100446021 (MAP2K1)
   04068 FoxO signaling pathway
    100446021 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100446021 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100446021 (MAP2K1)
   04024 cAMP signaling pathway
    100446021 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    100446021 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100446021 (MAP2K1)
   04150 mTOR signaling pathway
    100446021 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100446021 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100446021 (MAP2K1)
   04210 Apoptosis
    100446021 (MAP2K1)
   04218 Cellular senescence
    100446021 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100446021 (MAP2K1)
   04540 Gap junction
    100446021 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100446021 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100446021 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100446021 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    100446021 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100446021 (MAP2K1)
   04660 T cell receptor signaling pathway
    100446021 (MAP2K1)
   04662 B cell receptor signaling pathway
    100446021 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100446021 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100446021 (MAP2K1)
   04062 Chemokine signaling pathway
    100446021 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100446021 (MAP2K1)
   04929 GnRH secretion
    100446021 (MAP2K1)
   04912 GnRH signaling pathway
    100446021 (MAP2K1)
   04915 Estrogen signaling pathway
    100446021 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100446021 (MAP2K1)
   04917 Prolactin signaling pathway
    100446021 (MAP2K1)
   04921 Oxytocin signaling pathway
    100446021 (MAP2K1)
   04926 Relaxin signaling pathway
    100446021 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    100446021 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100446021 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100446021 (MAP2K1)
   04916 Melanogenesis
    100446021 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100446021 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    100446021 (MAP2K1)
   04726 Serotonergic synapse
    100446021 (MAP2K1)
   04720 Long-term potentiation
    100446021 (MAP2K1)
   04730 Long-term depression
    100446021 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100446021 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100446021 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100446021 (MAP2K1)
   05206 MicroRNAs in cancer
    100446021 (MAP2K1)
   05205 Proteoglycans in cancer
    100446021 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100446021 (MAP2K1)
   05231 Choline metabolism in cancer
    100446021 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100446021 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100446021 (MAP2K1)
   05212 Pancreatic cancer
    100446021 (MAP2K1)
   05225 Hepatocellular carcinoma
    100446021 (MAP2K1)
   05226 Gastric cancer
    100446021 (MAP2K1)
   05214 Glioma
    100446021 (MAP2K1)
   05216 Thyroid cancer
    100446021 (MAP2K1)
   05221 Acute myeloid leukemia
    100446021 (MAP2K1)
   05220 Chronic myeloid leukemia
    100446021 (MAP2K1)
   05218 Melanoma
    100446021 (MAP2K1)
   05211 Renal cell carcinoma
    100446021 (MAP2K1)
   05219 Bladder cancer
    100446021 (MAP2K1)
   05215 Prostate cancer
    100446021 (MAP2K1)
   05213 Endometrial cancer
    100446021 (MAP2K1)
   05224 Breast cancer
    100446021 (MAP2K1)
   05223 Non-small cell lung cancer
    100446021 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100446021 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    100446021 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    100446021 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100446021 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100446021 (MAP2K1)
   05135 Yersinia infection
    100446021 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100446021 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    100446021 (MAP2K1)
   05161 Hepatitis B
    100446021 (MAP2K1)
   05160 Hepatitis C
    100446021 (MAP2K1)
   05164 Influenza A
    100446021 (MAP2K1)
   05163 Human cytomegalovirus infection
    100446021 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100446021 (MAP2K1)
   05165 Human papillomavirus infection
    100446021 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100446021 (MAP2K1)
   01522 Endocrine resistance
    100446021 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100446021 (MAP2K1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100446021 (MAP2K1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE7 family
   100446021 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 100446021
NCBI-ProteinID: XP_024088586
LinkDB
Position
15
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAVGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctctgcggtt
aacgggaccagctctgcggagaccaacttggaggccttgcagaagaagctggaggagcta
gagcttgatgagcagcagcgaaagcgccttgaggcctttcttacccagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggggctggcaatggcggt
gtggtgttcaaggtctcccacaagccttctggcctggtcatggccagaaagctaattcat
ctggagatcaaacccgcaatccggaaccagatcataagggagctgcaggttctgcatgag
tgcaactctccgtacatcgtgggtttctatggtgcattctacagcgatggcgagatcagt
atctgcatggagcacatggatggaggttctctggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatatctg
agggagaagcacaagatcatgcacagagatgtcaagccctccaacatcctagtcaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcatcgactctatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tctgtgcagtcagacatctggagcatgggactctctctggtagagatggcggttgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagatgcggctgagaccccacctaggccaaggacccctgggaggccccttagctcatat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgag
cctcctccaaaactgcccagtggagtgttcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacaccaacccatgctgttggcgtctaa

KEGG   Pongo abelii (Sumatran orangutan): 100450988
Entry
100450988         CDS       T01416                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04218  Cellular senescence
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04730  Long-term depression
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450988 (MAP2K2)
   04012 ErbB signaling pathway
    100450988 (MAP2K2)
   04014 Ras signaling pathway
    100450988 (MAP2K2)
   04015 Rap1 signaling pathway
    100450988 (MAP2K2)
   04370 VEGF signaling pathway
    100450988 (MAP2K2)
   04371 Apelin signaling pathway
    100450988 (MAP2K2)
   04066 HIF-1 signaling pathway
    100450988 (MAP2K2)
   04068 FoxO signaling pathway
    100450988 (MAP2K2)
   04072 Phospholipase D signaling pathway
    100450988 (MAP2K2)
   04071 Sphingolipid signaling pathway
    100450988 (MAP2K2)
   04024 cAMP signaling pathway
    100450988 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    100450988 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    100450988 (MAP2K2)
   04150 mTOR signaling pathway
    100450988 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100450988 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    100450988 (MAP2K2)
   04218 Cellular senescence
    100450988 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100450988 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100450988 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100450988 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100450988 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    100450988 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    100450988 (MAP2K2)
   04660 T cell receptor signaling pathway
    100450988 (MAP2K2)
   04662 B cell receptor signaling pathway
    100450988 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    100450988 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100450988 (MAP2K2)
   04929 GnRH secretion
    100450988 (MAP2K2)
   04912 GnRH signaling pathway
    100450988 (MAP2K2)
   04915 Estrogen signaling pathway
    100450988 (MAP2K2)
   04917 Prolactin signaling pathway
    100450988 (MAP2K2)
   04921 Oxytocin signaling pathway
    100450988 (MAP2K2)
   04926 Relaxin signaling pathway
    100450988 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    100450988 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    100450988 (MAP2K2)
   04916 Melanogenesis
    100450988 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100450988 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    100450988 (MAP2K2)
   04730 Long-term depression
    100450988 (MAP2K2)
   04722 Neurotrophin signaling pathway
    100450988 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450988 (MAP2K2)
   05206 MicroRNAs in cancer
    100450988 (MAP2K2)
   05205 Proteoglycans in cancer
    100450988 (MAP2K2)
   05230 Central carbon metabolism in cancer
    100450988 (MAP2K2)
   05231 Choline metabolism in cancer
    100450988 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100450988 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100450988 (MAP2K2)
   05225 Hepatocellular carcinoma
    100450988 (MAP2K2)
   05226 Gastric cancer
    100450988 (MAP2K2)
   05214 Glioma
    100450988 (MAP2K2)
   05216 Thyroid cancer
    100450988 (MAP2K2)
   05221 Acute myeloid leukemia
    100450988 (MAP2K2)
   05220 Chronic myeloid leukemia
    100450988 (MAP2K2)
   05218 Melanoma
    100450988 (MAP2K2)
   05211 Renal cell carcinoma
    100450988 (MAP2K2)
   05219 Bladder cancer
    100450988 (MAP2K2)
   05215 Prostate cancer
    100450988 (MAP2K2)
   05213 Endometrial cancer
    100450988 (MAP2K2)
   05224 Breast cancer
    100450988 (MAP2K2)
   05223 Non-small cell lung cancer
    100450988 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100450988 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    100450988 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100450988 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100450988 (MAP2K2)
   05135 Yersinia infection
    100450988 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100450988 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    100450988 (MAP2K2)
   05161 Hepatitis B
    100450988 (MAP2K2)
   05160 Hepatitis C
    100450988 (MAP2K2)
   05164 Influenza A
    100450988 (MAP2K2)
   05163 Human cytomegalovirus infection
    100450988 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100450988 (MAP2K2)
   05165 Human papillomavirus infection
    100450988 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100450988 (MAP2K2)
   01522 Endocrine resistance
    100450988 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100450988 (MAP2K2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100450988 (MAP2K2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE7 family
   100450988 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 100450988
NCBI-ProteinID: XP_024093085
LinkDB
Position
19
AA seq 400 aa
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVVDGEEGEPHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADL
KMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccctaccatcgccgag
ggcccgtcccctaccagcgagggcgcctccgaggcaaacctggtggacctgcagaagaag
ctggaggagctagaacttgacgagcagcagaagaagcgactggaagcctttctcacccag
aaagccaaggtcggcgaactcaaagacgatgacttcgaaaggatctcagagctgggcgcg
ggcaacggcggggtggtcaccaaagtccagcacagaccctcaggcctcatcatggccagg
aagctgatccaccttgagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtcctgcacgagtgcaactcgccgtacatcgtgggcttctacggggccttctacagcgat
ggggagatcagcatctgcatggagcacatggatggcggctccctggaccaggtgctgaaa
gaggccaagaggattcccgaggagatcctggggaaagtcagcatcgcggttctccggggc
ttggcgtacctccgagagaagcaccagatcatgcaccgagatgtgaagccctccaacatc
ctcgtgaactctagaggggagatcaagctgtgtgactttggggtgagcggccagctcatc
gactccatggccaactccttcgtgggcacgcgctcctacatggctccggagcggttgcag
ggcacacattactcggtgcagtcggacatctggagcatgggcctgtccctggtggagctg
gccatcggaaggtaccccatccccccgcccgacgccaaggagctggaggccatctttggc
cggcccgtggtcgacggggaagaaggagagcctcacagcatctcgcctcggccgaggccc
cccgggcgccccatcagcggtcacgggatggacagccggcccgccatggccatctttgaa
ctgctggactatattgtgaacgagccacctcctaagctgcccaacggggtgttcaccccc
gacttccaggagtttgtcaataaatgcctcatcaagaacccagcggagcgggcggacctg
aagatgctcacaaaccacaccttcatcaagcggtccgaggtggaagaagtggattttgct
ggctggttgtgtaaaaccctgcggctgaaccagcccggcacacccacgcgcaccgctgtg
tga

DBGET integrated database retrieval system