KEGG   Pongo abelii (Sumatran orangutan): 100446303
Entry
100446303         CDS       T01416                                 

Gene name
TRIM71
Definition
(RefSeq) E3 ubiquitin-protein ligase TRIM71
  KO
K12035  tripartite motif-containing protein 71 [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100446303 (TRIM71)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100446303 (TRIM71)
   04121 Ubiquitin system [BR:pon04121]
    100446303 (TRIM71)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100446303 (TRIM71)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     100446303 (TRIM71)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    100446303 (TRIM71)
SSDB
Motif
Pfam: NHL Filamin DUF5128 zf-B_box SGL zf-RING_5 zf-C3HC4 zf-RING_UBOX
Other DBs
NCBI-GeneID: 100446303
NCBI-ProteinID: XP_003776339
Ensembl: ENSPPYG00000014036
LinkDB
Position
3
AA seq 868 aa
MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLP
CLHAFCRPCLEAHRLPAAGGGAPGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLL
DAVVATADEPPPKNGRAGTPAGAGGHSNHRHHAHHAHPRASASAPPLPQAPQPPAPSRSA
PGGPAASPSALLLRRPHGCSSCDEGNAASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIER
GPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRE
CTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVAEQVEMKAKVV
QSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQ
VLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSS
GAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFAAEV
SDQQNGTYVVSYRPQLEGEHLVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEG
DSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVA
CDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTR
NHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQS
ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQ
MDRPSGIAITPDGMIVVVDFGNNRILVF
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggcttcgttccccgagaccgatttccagatctgcttgctgtgcaaggagatgtgcggc
tcgccggcgccgctctcctccaactcgtccgcgtcgtcgtcgtcctcgcagacgtccacg
tcgtcggggggcggcggcgggggccctggggcggcggcgcgccgcctacacgtcctgccc
tgcctgcacgccttctgccgcccctgcctcgaggcgcaccggctgccggcggcgggcggc
ggcgcgccgggagagccgctcaagctgcgctgccccgtgtgcgaccagaaagtagtgcta
gccgaggcggcgggcatggacgcgctgccttcgtccgccttcctgcttagcaacctgctt
gacgcggtggtggccactgccgacgagccgccgcccaagaacgggcgcgccggcactccg
gcgggagcgggcggccacagcaaccaccggcaccacgctcaccacgcgcacccgcgcgcg
tccgcctccgcgccgccactcccgcaggcgccgcagccgcccgcgccttcccgctcggca
cccggcggcccggccgcttccccgtcggcgctgctgctccgccggcctcacggctgcagc
tcgtgcgatgagggcaacgcagcttcttcgcgctgcctcgactgccaggagcacctgtgc
gacaactgcgtccgagcgcaccagcgcgtgcgcctcaccaaggaccactacattgagcgc
ggcccgccgggtcccggtgccgcggcagcggcgcagcagctcgggctcgggccgcccttt
cccggcccgcccttctccatcctctcagtgtttcccgagcgcctcggcttctgccagcac
cacgacgacgaggtgctgcacctgtactgtgacacttgctctgtacccatctgtcgtgag
tgcacaatgggccggcacggaggccacagcttcatctacctccaggaggcgctgcaggac
tcgcgggcactcaccatccagctgctggcagatgcccagcagggacgacaggcaatccag
ctgagcatcgagcaggcccagacggtggcggaacaggtggagatgaaggcgaaggttgta
cagtcggaggtcaaagccgtgactgcgaggcataagaaagctctggaggaacgcgagtgt
gagctgctgtggaaggtagaaaagatccgccaggtgaaagccaagtctctgtacctgcag
gtggagaagctgcgacaaaacctcaacaagcttgagagcaccatcagtgccgtgcagcag
gtcctggaggagggtagagcgctagacatcctactggcccgagaccggatgctggcccag
gtgcaggagctgaagaccgtgcggagcctcctgcagccccaggaagatgaccgagtcatg
ttcacaccccccgatcaggcactgtaccttgccatcaagtcttttggctttgttagcagc
ggggcctttgcaccactcaccaaggccacgggcgatggcctcaagcgcgccctccagggt
aaggtggcctccttcacggtcattggttatgaccacgatggtgagccccgcctctcagga
ggtgacctgatgtcggctgtggtcctgggccctgatggcaacctgtttgctgcagaggtg
agtgatcagcagaatgggacatatgtggtgagttaccggccccagctggagggtgagcat
ctggtatctgtgacactgtgcaaccagcacattgagaacagccctttcaaggtggtggtc
aagtcaggccgcagctacgtgggcattgggctcccgggcctgagcttcggcagtgagggt
gacagcgatggcaagctctgccgcccttggggtgtgagtgtagacaaggagggctacatc
atcgtcgccgaccgcagcaacaaccgcatccaggtgttcaagccctgcggtgccttccac
cacaaatttggcaccctgggctcccggcctgggcagttcgaccgaccagccggcgtggcc
tgtgacgcctcacgcaggatcgtggtggctgacaaggacaatcatcgcatccagatcttc
accttcgagggccagttcctcctcaagtttggtgagaaaggaaccaagaatgggcagttc
aattacccttgggatgtggcggtgaattctgagggcaagatcctggtctcagacacgagg
aaccaccggatccagctgtttgggcctgatggtgtcttcctaaataagtatggcttcgag
ggggctctctggaagcactttgactccccacggggtgtggccttcaaccatgagggccac
ttggtggtcaccgacttcaacaaccaccggctcctggttattcaccccgactgccagtcg
gcacgctttctgggctcggagggcacgggcaatgggcagttcctgcgcccacaaggggta
gctgtggaccaggaagggcgcatcattgtggcggattccaggaaccatcgggtacagatg
tttgaatccaacggcagcttcctgtgcaagtttggtgctcaaggcagcggctttgggcag
atggaccgcccttccggcatcgccatcacccccgatggaatgatcgttgtggtagacttt
ggcaacaatcgaatcctcgtcttctaa

DBGET integrated database retrieval system