KEGG   Pongo abelii (Sumatran orangutan): 100447057
Entry
100447057         CDS       T01416                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04664  Fc epsilon RI signaling pathway
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05221  Acute myeloid leukemia
pon05310  Asthma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100447057 (IL3)
   04151 PI3K-Akt signaling pathway
    100447057 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100447057 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100447057 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100447057 (IL3)
   04664 Fc epsilon RI signaling pathway
    100447057 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447057 (IL3)
   05202 Transcriptional misregulation in cancer
    100447057 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100447057 (IL3)
  09163 Immune disease
   05310 Asthma
    100447057 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447057 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100447057 (IL3)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100447057 (IL3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Haparin
  Cytokines
   100447057 (IL3)
SSDB
Motif
Pfam: IL3 Ldl_recept_b
Other DBs
NCBI-GeneID: 100447057
NCBI-ProteinID: XP_002815901
Ensembl: ENSPPYG00000015753
UniProt: A0A663D7Y1 H2PGH1
LinkDB
Position
5
AA seq 152 aa
MSCLPVLLLLQLLVSPGLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNKAVKSLQNASAIESILKNLPPCLPMATAAPMRHPIRIKD
GDWNEFRRKLTFYLKTLENAQAQQMTLSVEIS
NT seq 459 nt   +upstreamnt  +downstreamnt
atgagctgcctgcccgtcctgctcctgctccaactcctggtcagccccggactccaagct
cccatgacccagacaacttccttgaagacaagctgggttaactgctctaacatgattgat
gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataacctccgaaggccaaacctggaggcattc
aacaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc
ccgccatgcctgcccatggccacggccgcacccatgcgacatccaatccgtatcaaggac
ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgca
caggctcaacagatgactttgagcgtcgagatctcttga

DBGET integrated database retrieval system