KEGG   Pongo abelii (Sumatran orangutan): 100447086
Entry
100447086         CDS       T01416                                 

Gene name
MMP16
Definition
(RefSeq) matrix metalloproteinase-16 isoform X1
  KO
K07996  matrix metalloproteinase-16 (membrane-inserted) [EC:3.4.24.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100447086 (MMP16)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100447086 (MMP16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100447086 (MMP16)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     100447086 (MMP16)
Peptidases and inhibitors [BR:pon01002]
 Metallo peptidases
  Family M10
   100447086 (MMP16)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M66 Peptidase_M54 Metallopep Reprolysin_3 DUF4953
Other DBs
NCBI-GeneID: 100447086
NCBI-ProteinID: XP_024107098
LinkDB
Position
8
AA seq 607 aa
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVK
EGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgatcttactcacattcagcactggaagacggttggatttcgtgcatcattcgggagtg
tttttcttgcaaaccttgctttggattttatgtgctacagtctgcggaacggagcagtat
ttcaatgtggaggtttggttacaaaagtacggctaccttccaccgactgaccccagaatg
tcagtgctgcgctctgcagagaccatgcagtctgccctagctgccatgcagcagttctat
ggcattaacatgacaggaaaagtggacagaaacacaattgactggatgaagaagccccga
tgcggtgtacctgaccagacaagaggtagctccaaatttcatattcgtcgaaagcgatat
gcattgacaggacagaaatggcagcacaagcacatcacttacagtataaagaacgtaact
ccaaaagtaggagaccctgagactcgtaaagctattcgtcgtgcctttgatgtgtggcag
aatgtaactcctctgacatttgaagaagttccctacagtgaattagaaaatggcaaacgt
gatgtggatataaccattatttttgcatctggtttccatggggacagttctccctttgat
ggagagggaggatttttggcacatgcctacttccctggaccaggaattggaggagatacc
cattttgactcagatgagccatggacactaggaaatcctaatcacgatggaaatgactta
tttcttgtagcagttcatgaactgggacatgctctgggattggagcattccaatgacccc
actgccatcatggccccattttaccaatacatggaaacagacaacttcaaactccctaat
gatgacttacagggcatccagaagatatatggtccacctgacaagattcctccacctaca
agacctctaccgacagtgcccccacaccgctctattcctccggctgacccaaggaaaaat
gacaggccaaaacctcctcggcctccaaccggcagaccctcctatcccggagccaaaccc
aacatctgtgatgggaactttaacactctagctattcttcgccgtgagatgtttgttttc
aaggaccagtggttttggcgagtgagaaacaacagggtgatggatggatacccaatgcaa
attacttacttctggcggggcttgcctcctagtatcgatgcagtttatgaaaatagcgac
gggaattttgtgttctttaaaggtaacaaatactgggtgttcaaggatacaactcttcaa
cctggttaccctcatgacttgataacccttggaagtggaattccccctcatggtattgat
tcagccatttggtgggaggacgttgggaaaacctatttcttcaagggagacagatattgg
agatatagtgaagaaatgaaaacaatggaccctggctatcccaagccaatcacagtctgg
aaagggatccctgaatctcctcagggagcatttgtacacaaagaaaatggctttacgtat
ttctacaaaggaaaggagtattggaaattcaacaaccagatactcaaggtagaacctgga
tatccaagatccatcctcaaggattttatgggctgtgatggaccaacagacagagttaaa
gaaggacacagcccaccagatgatgtagacattgtcatcaaactggacaacacagccagc
actgtgaaagccatagctattgtcattccctgcatcttggccttatgcctccttgtattg
gtttacactgtgttccagttcaagaggaaaggaacaccccgccacatactgtactgtaaa
cgctctatgcaagagtgggtgtga

DBGET integrated database retrieval system