KEGG   Pongo abelii (Sumatran orangutan): 100447185
Entry
100447185         CDS       T01416                                 

Gene name
DRD1
Definition
(RefSeq) D(1A) dopamine receptor
  KO
K04144  dopamine receptor D1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04540  Gap junction
pon04728  Dopaminergic synapse
pon05012  Parkinson disease
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05032  Morphine addiction
pon05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100447185 (DRD1)
   04024 cAMP signaling pathway
    100447185 (DRD1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100447185 (DRD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100447185 (DRD1)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100447185 (DRD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100447185 (DRD1)
  09165 Substance dependence
   05030 Cocaine addiction
    100447185 (DRD1)
   05031 Amphetamine addiction
    100447185 (DRD1)
   05032 Morphine addiction
    100447185 (DRD1)
   05034 Alcoholism
    100447185 (DRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100447185 (DRD1)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    100447185 (DRD1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100447185
NCBI-ProteinID: XP_002816273
Ensembl: ENSPPYG00000016062
UniProt: H2PHF2
LinkDB
Position
5
AA seq 446 aa
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaggactctgaacacctctgccatggatgggactgggctggtggtagagagggacttc
tctgttcgtatcctcactgcctgtttcctgtcgctgctcatcctgtccacgctcctgggg
aacacgctggtctgtgctgcggttatcaggttccgacacctgcggtccaaggtgaccaac
ttctttgtcatctccttggctgtgtcagatctcttggtggccgtcttggtcatgccctgg
aaagcagtggctgagattgctggcttctggccctttgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccaccgcttccatcctcaacctctgtgtgatcagcgtggac
aggtattgggctatctccagccctttccggtatgagagaaagatgacccccaaggcagcc
ttcatcctgatcagtgtggcatggaccttgtctgtactcatctccttcatcccagtgcag
ctcagctggcacaaggcaaaacccacaagcccgtctgatggaaatgccacttccttggct
gagaccatagacaactgtgactccagcctcagcaggacatatgccatctcatcctctgta
ataagcttttacatccctgtggccatcatgattgtcacctacaccaggatctacaggatt
gctcagaaacaaatacggcgcattgcagccttggagagggcagcagtccatgccaagaat
tgccagaccaccacaggtaatggaaagcctgtcgaatgttctcaaccggaaagttctttt
aagatgtccttcaaaagagaaactaaagtcctgaagactctgtcggtgatcatgggtgtg
tttgtatgctgttggctacctttcttcatcttgaactgcattttgcccttctgtgggtct
ggggagacgcagcccttctgcattgattccatcacctttgatgtgtttgtgtggtttggg
tgggctaattcatccttgaaccccatcatttatgcctttaatgctgattttcggaaggca
ttttcaaccctcttaggatgctacagactttgccctgcgacgaataatgccatagagacg
gtgagtatcaataacaatggggctgcgatgttttccagccatcacgagccacgaggctcc
atctccaaggagtgcaatctggtttacctgatcccacatgctgtgggctcctctgaggac
ctgaaaaaggaggaggcagctggcatcgccagacccttggagaagctgtccccagcccta
tcggtcatattggactatgacactgacgtctctctggagaagatccaacccatcacacaa
aacggacagcacccaacctga

DBGET integrated database retrieval system