KEGG   Pongo abelii (Sumatran orangutan): 100447214
Entry
100447214         CDS       T01416                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04218  Cellular senescence
pon04714  Thermogenesis
pon04910  Insulin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05168  Herpes simplex virus 1 infection
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100447214 (RHEB)
   04151 PI3K-Akt signaling pathway
    100447214 (RHEB)
   04152 AMPK signaling pathway
    100447214 (RHEB)
   04150 mTOR signaling pathway
    100447214 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100447214 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    100447214 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100447214 (RHEB)
   04919 Thyroid hormone signaling pathway
    100447214 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    100447214 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100447214 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100447214 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100447214 (RHEB)
   05163 Human cytomegalovirus infection
    100447214 (RHEB)
   05165 Human papillomavirus infection
    100447214 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100447214 (RHEB)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    100447214 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 100447214
NCBI-ProteinID: XP_024105360
Ensembl: ENSPPYG00000018196
LinkDB
Position
7
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa
aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac
acagccgggcaagatgaatattctatctttcctcagacatactccatagatattaatggc
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat
ggcaaattgttggatatggtggggaaagtacaaatacctattatgttggttgggaataag
aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct
tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt
cgaaggataattttggaggcagaaaaaatggacggggcagcttcacaaggcaagtcttca
tgctcggtgatgtga

DBGET integrated database retrieval system