KEGG   Pongo abelii (Sumatran orangutan): 100447558
Entry
100447558         CDS       T01416                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01523  Antifolate resistance
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04064  NF-kappa B signaling pathway
pon04071  Sphingolipid signaling pathway
pon04150  mTOR signaling pathway
pon04210  Apoptosis
pon04217  Necroptosis
pon04350  TGF-beta signaling pathway
pon04380  Osteoclast differentiation
pon04612  Antigen processing and presentation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04640  Hematopoietic cell lineage
pon04650  Natural killer cell mediated cytotoxicity
pon04657  IL-17 signaling pathway
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04920  Adipocytokine signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04940  Type I diabetes mellitus
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05205  Proteoglycans in cancer
pon05310  Asthma
pon05321  Inflammatory bowel disease
pon05322  Systemic lupus erythematosus
pon05323  Rheumatoid arthritis
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100447558 (TNF)
   04350 TGF-beta signaling pathway
    100447558 (TNF)
   04064 NF-kappa B signaling pathway
    100447558 (TNF)
   04668 TNF signaling pathway
    100447558 (TNF)
   04071 Sphingolipid signaling pathway
    100447558 (TNF)
   04150 mTOR signaling pathway
    100447558 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100447558 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100447558 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100447558 (TNF)
   04217 Necroptosis
    100447558 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100447558 (TNF)
   04620 Toll-like receptor signaling pathway
    100447558 (TNF)
   04621 NOD-like receptor signaling pathway
    100447558 (TNF)
   04622 RIG-I-like receptor signaling pathway
    100447558 (TNF)
   04625 C-type lectin receptor signaling pathway
    100447558 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    100447558 (TNF)
   04612 Antigen processing and presentation
    100447558 (TNF)
   04660 T cell receptor signaling pathway
    100447558 (TNF)
   04657 IL-17 signaling pathway
    100447558 (TNF)
   04664 Fc epsilon RI signaling pathway
    100447558 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100447558 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100447558 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100447558 (TNF)
  09163 Immune disease
   05310 Asthma
    100447558 (TNF)
   05322 Systemic lupus erythematosus
    100447558 (TNF)
   05323 Rheumatoid arthritis
    100447558 (TNF)
   05321 Inflammatory bowel disease
    100447558 (TNF)
   05330 Allograft rejection
    100447558 (TNF)
   05332 Graft-versus-host disease
    100447558 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100447558 (TNF)
   05014 Amyotrophic lateral sclerosis
    100447558 (TNF)
   05020 Prion disease
    100447558 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    100447558 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100447558 (TNF)
   05410 Hypertrophic cardiomyopathy
    100447558 (TNF)
   05414 Dilated cardiomyopathy
    100447558 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100447558 (TNF)
   04940 Type I diabetes mellitus
    100447558 (TNF)
   04932 Non-alcoholic fatty liver disease
    100447558 (TNF)
   04931 Insulin resistance
    100447558 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100447558 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100447558 (TNF)
   05135 Yersinia infection
    100447558 (TNF)
   05133 Pertussis
    100447558 (TNF)
   05134 Legionellosis
    100447558 (TNF)
   05152 Tuberculosis
    100447558 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100447558 (TNF)
   05170 Human immunodeficiency virus 1 infection
    100447558 (TNF)
   05161 Hepatitis B
    100447558 (TNF)
   05160 Hepatitis C
    100447558 (TNF)
   05171 Coronavirus disease - COVID-19
    100447558 (TNF)
   05164 Influenza A
    100447558 (TNF)
   05168 Herpes simplex virus 1 infection
    100447558 (TNF)
   05163 Human cytomegalovirus infection
    100447558 (TNF)
   05169 Epstein-Barr virus infection
    100447558 (TNF)
   05165 Human papillomavirus infection
    100447558 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100447558 (TNF)
   05144 Malaria
    100447558 (TNF)
   05145 Toxoplasmosis
    100447558 (TNF)
   05140 Leishmaniasis
    100447558 (TNF)
   05142 Chagas disease
    100447558 (TNF)
   05143 African trypanosomiasis
    100447558 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100447558 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447558 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100447558 (TNF)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Tumor necrosis fators
   100447558 (TNF)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Cytokines
   100447558 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100447558
NCBI-ProteinID: XP_002816766
Ensembl: ENSPPYG00000016437
UniProt: H2PII1 A0A663D6D9
LinkDB
Position
6
AA seq 233 aa
MSTESMIRDVELAEEALPKKTGGPHGSRRCLFLSLVSFLIVAGATTLFCLLHFGVIGPQR
EEFPKDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TTEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag
acaggggggccccatggctccaggcggtgcttgttcctcagcctcgtctccttcctgatc
gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagttccccaaggacctctctctaatcagccctctggcccaggcagtcagatcatct
tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga
gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
accacagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc
cagctggagaagggtgatcgactcagcgctgagatcaatctgcccaactatctcgacttt
gccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system