KEGG   Pongo abelii (Sumatran orangutan): 100447844
Entry
100447844         CDS       T01416                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl-releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04611  Platelet activation
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100447844 (RASGRP2)
   04014 Ras signaling pathway
    100447844 (RASGRP2)
   04015 Rap1 signaling pathway
    100447844 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100447844 (RASGRP2)
   04062 Chemokine signaling pathway
    100447844 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447844 (RASGRP2)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100447844 (RASGRP2)
SSDB
Motif
Pfam: RasGEF EF-hand_1 C1_1 EF-hand_6 EF-hand_7 EF-hand_5 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 100447844
NCBI-ProteinID: XP_024111623
LinkDB
Position
11
AA seq 609 aa
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNLRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggcgggcaccctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaggacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctccgccttcccagcggagtttgacttgaacccggagctggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaacctgcggcacagcagcctcatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccctgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
tttgtgactcatggctgcactgtggacaaccccgtcctggagcgattcatctccctcttc
aacagcgtctcgcagtgggtgcagctcatgatcctcagcaaacccacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcggagaagctgctgcagctgcagaacttc
aacacactgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacggaactagtg
acggcaacaggcaactatggcaactaccggcgtcggctggcagcctgtgtgggcttccgc
ttccctatcctgggtgtgcacctcaaggacctggtggccctgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccagctg
tccctgcagcgggagccacgctccaagtcctcgccaaccagccccacgagttgcacccca
ccaccccggcccccggtgctggaggagtggacatcggctgccaaacccaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtctcctatttcctgcgctccagctccgtgttggggggccgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgccctgtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggtgtgaactgccacaagcagtgc
aaggatcgcctgtcagtcgagtgtcggcgcagggcccagagtgtgagcctggaggggtct
gcaccctcaccctcacccacccacagccaccatcaccgcgccttcagcttctctctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagacggtg
gaggatggggtgtttgacatccacttgtaa

DBGET integrated database retrieval system