KEGG   Pongo abelii (Sumatran orangutan): 100447953
Entry
100447953         CDS       T01416                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00220  Arginine biosynthesis
pon00330  Arginine and proline metabolism
pon01100  Metabolic pathways
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04066  HIF-1 signaling pathway
pon04071  Sphingolipid signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04611  Platelet activation
pon04915  Estrogen signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04931  Insulin resistance
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100447953 (NOS3)
   00330 Arginine and proline metabolism
    100447953 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100447953 (NOS3)
   04371 Apelin signaling pathway
    100447953 (NOS3)
   04066 HIF-1 signaling pathway
    100447953 (NOS3)
   04020 Calcium signaling pathway
    100447953 (NOS3)
   04071 Sphingolipid signaling pathway
    100447953 (NOS3)
   04022 cGMP-PKG signaling pathway
    100447953 (NOS3)
   04151 PI3K-Akt signaling pathway
    100447953 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100447953 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100447953 (NOS3)
   04921 Oxytocin signaling pathway
    100447953 (NOS3)
   04926 Relaxin signaling pathway
    100447953 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100447953 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100447953 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100447953 (NOS3)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100447953 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 100447953
NCBI-ProteinID: XP_024106111
Ensembl: ENSPPYG00000018178
LinkDB
Position
7
AA seq 1203 aa
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPGHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQAQDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSATKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDLSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtggcccaggagcctgggccaccctgcggcctggggctgggg
ctgggcctcgggctgtgcggcaagcagggcccagccaccccagcccctgagcccagccgg
gccccagcatccctactcccgccagcgccaggacacagccccccgagctccccgctaacc
cagcccccggaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcacc
tatgacaccctcagcgcccaggcgcagcaggatgggccctgcaccccaagacgctgcctg
ggctccctggtatttccacggaaactacagggccggccctcccccggccccccggcccct
gagcagctgctgagtcaggcccaggacttcatcaaccagtactacagctccattaagagg
agcggctcccaagcccacgaacagcggcttcaagaggtggaagccgaggtggcagccaca
ggcacctaccagcttagggaaagcgagctggtgttcggggccaagcaggcctggcgcaat
gctccccgctgtgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggac
tgcaggtctgcacaggaaatgttcacctacatctgcaaccacatcaagtatgccaccaac
cggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgaggagac
ttccgaatctggaacagccagctggtgcgctatgcgggctaccggcagcaggacggctct
gtgcggggggacccagccaacgtggagatcaccgagctctgcattcagcacggctggacc
ccaggaaacggtcgcttcgacgtgctgcccctgctgctgcaggccccagatgagccccca
gaactcttcctactgccccccgagctggtccttgaggtgcccctggagcaccccacgctg
gagtggtttgcagccctgggcctgcgctggtacgccctcccggcagtgtccaacatgctg
ctggaaattgggggcctggagttccccgcagcccccttcagtggctggtacatgagcact
gagatcggcacgaggaacctgtgtgaccctcaccgctacaacatcctggaggatgtggct
gtctgcatggacctggatacccggacaacctcgtccctgtggaaagacaaggcagcagtg
gaaatcaacgtggccgtgctgcacagttaccagctggccaaagtcaccatcgtggaccac
cacgccgccacggcctccttcatgaagcacctggagaatgagcagaaggccagggggggc
tgccctgcggactgggcctggattgtgccccccatctcgggcagcctcactcctgtcttc
catcaggagatggtcaactatttcctgtccccggccttccgctaccagccagacccctgg
aaggggagtgccaccaagggcactggcatcaccaggaagaagaccttcaaagaagtggcc
aacgccgtgaagatctccgcctcgctgatgggcacggtgatggcaaagcgagtgaaggcc
acaattctgtatggctccgagaccggccgggcccagagctacgcacagcagctggggaga
ctcttccggaaagcttttgacccccgggtcctgtgtatggatgagtatgacgtggtgtcc
ctcgaacacgagacgctggtgctggtggtaaccagcacatttgggaatggggatcccccg
gagaatggagagagctttgcggctgccctgatggagatgtccggcccctacaacagctcc
cctcggccggaacagcacaagagttataagatccgcttcaacagcatctcctgctcagac
ccactggtgtcctcttggcggcggaagaggaaggagtccagtaacacagacagtgcaggg
gccctgggcaccctcaggttctgtgtgttcgggctgggctcccgggcatacccccacttc
tgcgcctttgctcgtgcggtggacacacggctggaggaactgggcggggagcggctgctg
cagctgggccagggcgacgagctgtgcggccaggaggaggccttccgcggctgggcccag
gccgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggccgccgcc
cgagacatcttcagccccaaacggagctggaagcgccagaggtaccggctgagcgcccag
gccgagggcctgcagttgctgccaggtctgatccacgtgcacaggcggaagatgttccag
gctacagtcctctcagtggaaaacctgcaaagcagcaagtccacgagggccaccatcctg
gtgcgcctggacaccggaggccaggaggggctgcagtatcagccgggggaccacataggt
gtctgcccacccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccg
ccggcgcccactgagcccgtggcagtagagcagctggagaagggcagccctggtggccct
ccccccggctgggtgcgggacccccggctgcccccgtgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccacccagccctcagctcttgcggctgctcagcaccttg
gcagaagagcccagagaacagcaggagctggaggccctcagccaggatccccgacgctac
gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccgtcg
gtggcactgcctgccccactgctcctcacccagctgcctctgctccagccccggtactac
tcagtcagctcagcacccagcacccacccaggagagatccacctcactgtagctgtgctg
gcatacaggacccaggatgggctgggccccctgcactatggagtctgctccacgtggcta
agccaacttaagcctggagaccctgtgccctgcttcatccggggggctccctccttccgg
ctgccacccgatctcagcttgccctgcatcctggtgggcccaggcactggcattgccccc
ttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccact
cccatgactttggtgttcggctgccgatgctcccaactcgaccatctctaccgcgacgag
gtgcagaacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgggaa
cctgacaaccccaagacctacgtgcaggacatcctgaggacagagctggctgcggaggtg
caccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcaccatggca
accaacgtcctgcagaccgtgcagcgcatcttggcgacggagggcgacatggagctggac
gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacattttc
gggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttg
caggagcggcagttgcggggcgcagtgccctgggcgttcgacccgcccggctcagacacc
aacagcccatga

DBGET integrated database retrieval system