KEGG   Pongo abelii (Sumatran orangutan): 100447959
Entry
100447959         CDS       T01416                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon04935  Growth hormone synthesis, secretion and action
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05146  Amoebiasis
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05222  Small cell lung cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100447959 (PTK2)
   04370 VEGF signaling pathway
    100447959 (PTK2)
   04151 PI3K-Akt signaling pathway
    100447959 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100447959 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100447959 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100447959 (PTK2)
   04062 Chemokine signaling pathway
    100447959 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100447959 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    100447959 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447959 (PTK2)
   05202 Transcriptional misregulation in cancer
    100447959 (PTK2)
   05205 Proteoglycans in cancer
    100447959 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100447959 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100447959 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100447959 (PTK2)
   05100 Bacterial invasion of epithelial cells
    100447959 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100447959 (PTK2)
   05163 Human cytomegalovirus infection
    100447959 (PTK2)
   05165 Human papillomavirus infection
    100447959 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100447959 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100447959 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100447959 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100447959 (PTK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100447959 (PTK2)
Protein kinases [BR:pon01001]
 Non-receptor tyrosine kinases
  FAK family
   100447959 (PTK2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100447959 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100447959
NCBI-ProteinID: XP_024107244
Ensembl: ENSPPYG00000018909
LinkDB
Position
8
AA seq 1106 aa
MWNPLTWMADCIAELGLLCIFQLQIQCLLQFPQSSSRITEEYDRYLASSKIMAAAYLDPN
LNHTPNSSTKTHLGTGIERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQ
KIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYL
PKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALE
KKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSP
VYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSED
KDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFIIRPQKEGERA
LPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIG
EGQFGDVHQGVYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGV
ITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAA
RNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFG
VCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRF
TELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGF
YPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVE
DSTALDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDG
SLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKPWRLQP
QEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLA
TVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHA
LAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgtggaacccgctgacatggatggctgactgtattgcagaactggggctcctttgcatc
ttccagttacaaattcagtgccttctgcagtttccccagagctcctcaagaataacggaa
gaatatgacagatacctagcatctagcaaaataatggcagctgcttaccttgaccccaac
ttgaatcacacgccaaattcgagtactaagactcacctgggtactggtatagaacgttct
cctggtgcgatggagcgagtattaaaggtctttcattattttgaaagcaatagtgagcca
accacctgggccagtattatcaggcatggagatgctactgatgtcaggggcatcattcag
aagatagtggacagtcacaaagtaaagcatgtggcctgctatggattccgcctcagtcac
ctgcggtcagaggaggttcactggcttcacgtggatatgggcgtctccagtgtgagggag
aagtatgagcttgctcacccaccagaggagtggaaatatgaattgagaattcgttatttg
ccaaaaggatttctaaaccagtttactgaagataagccaactttgaatttcttctatcaa
caggtgaagagcgattatatgttagagatagctgatcaagtggaccaggaaattgctttg
aagttgggttgtctagaaatacggcgatcatactgggagatgcggggcaatgcactagaa
aagaagtctaactatgaagtattagaaaaagatgttggtttaaagcgattttttcctaag
agtttactggattctgtcaaggccaaaacactaagaaaactgatccaacaaacatttaga
caattcgccaaccttaatagagaagaaagtattctgaaattctttgagatcctgtctcca
gtctacagatttgataaggaatgcttcaagtgtgctcttggttcaagctggattatttca
gtggaactggcaatcggcccagaagaagggatcagttacctaacggacaagggctgcaat
cccacacatcttgctgacttcactcaagtgcaaaccattcagtattcaaacagtgaagac
aaggacagaaaaggaatgctacaactaaaaatagcaggtgcacccgagcctctgacagtg
acggcaccatccctaaccattgcggagaatatggctgacctgatagatgggtactgccgg
ctggtgaatggagcctcacagtcatttatcatcagaccccagaaagaaggtgaacgggct
ttgccatcaataccaaagttggccaacagcgaaaagcaaggcatgcggacacacgccgtc
tctgtgtcagaaacagatgattatgctgagattatagatgaagaagatacttacaccatg
ccctcaaccagggattatgagattcaaagagaaagaatagaacttggacgatgtattgga
gaaggccaatttggagatgtacatcaaggcgtttatatgagtccagagaatccagctttg
gcggttgcaattaaaacatgtaaaaactgtacttcggacagcgtgagagagaaatttctt
caagaagccttaacaatgcgtcagtttgaccatcctcatattgtgaagctgattggagtc
atcacagagaatcctgtctggataatcatggagctgtgcacacttggagagctgaggtca
tttttgcaagtaaggaaatacagtttggatctagcatctttgatcctgtatgcctatcag
cttagtacagctcttgcatatctagagagcaaaagatttgtacacagggacattgctgct
cggaatgttctggtgtcctcaaatgattgtgtaaaattaggagactttggattatcccga
tatatggaagatagtacttactacaaagcttccaaaggaaaattgcctattaaatggatg
gctccagagtcaatcaattttcgacgttttacctcagctagtgacgtatggatgtttggt
gtgtgtatgtgggagatactgatgcatggtgtgaagccttttcaaggagtgaagaacaat
gatgtaatcggtcgaattgaaaatggggaaagattaccaatgcctccaaattgtcctcct
accctctacagccttatgacgaaatgctgggcctatgaccccagcaggcggcccaggttt
actgaacttaaagctcagctcagcacaatcctggaggaagagaaggctcagcaagaagag
cgcatgaggatggagtccagaagacaggccacagtgtcctgggactccggagggtctgat
gaagcgccgcccaagcccagcagaccgggttatcctagtccgaggtccagtgaaggattt
tatcccagcccacagcacatggtacaaaccaatcattaccaggtttctggctaccctggt
tcacatggaatcacagccatggctggcagcatctatccaggtcaggcatctcttttggac
caaacagattcatggaatcatagacctcaggagatagcaatgtggcagcccaatgtggag
gactctacagcattggacctgcgagggattgggcaagtgttgccaacccatctgatggaa
gagcggctaatccgacagcaacaggaaatggaagaagatcagcgctggctggaaaaagag
gaaagatttctgaaacctgatgtgagactctctcgaggcagtattgacagggaggatgga
agtcttcagggtccgattggaaaccaacatatatatcagcctgtgggtaaaccagatcct
gcagctccaccaaagaaaccgcctcgccctggagctcccggtcatctgggaagccttgcc
agcctcagcagccctgctgacagctacaacgagggtgtcaagccatggaggcttcagccc
caggaaatcagtccccctcctactgccaacctggaccggtcgaatgataaggtgtacgag
aatgtgacgggcctggtgaaagctgtcatcgagatgtccagtaaaatccagccagcccca
ccagaggagtatgtccctatggtgaaggaagtcggcttggccctgaggacgttattggcc
actgtggatgagaccattcccctcctaccagccagcacccaccgagagattgagatggca
cagaaactattgaactctgacctgggcgagctcatcaacaagatgaaactggcccagcag
tatgtcatgaccagcctccagcaagagtacaaaaagcaaatgctgactgctgctcacgcc
ctggctgtggatgccaaaaacttactcgatgtcattgaccaagcaagactgaaaatgctt
gggcagacgagaccacactga

DBGET integrated database retrieval system