KEGG   Pongo abelii (Sumatran orangutan): 100448038
Entry
100448038         CDS       T01416                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04330  Notch signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100448038 (DVL3)
   04330 Notch signaling pathway
    100448038 (DVL3)
   04390 Hippo signaling pathway
    100448038 (DVL3)
   04150 mTOR signaling pathway
    100448038 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100448038 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100448038 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448038 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100448038 (DVL3)
   05226 Gastric cancer
    100448038 (DVL3)
   05217 Basal cell carcinoma
    100448038 (DVL3)
   05224 Breast cancer
    100448038 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100448038 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    100448038 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100448038 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100448038 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100448038
NCBI-ProteinID: XP_024100317
LinkDB
Position
3
AA seq 718 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLALHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPTKNFGLFDFL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacttggatgggcaggagacaccgtaccttgtgaag
ctgcccctgcccgccgagcgtgtcaccttggcagactttaagggcgttttgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggagatc
tcggatgacaatgccaagctaccatgcttcaatggccgggtggtgtcctggctggtgtca
gctgaaggctcacacccagacccagcccccttctgtgctgacaacccatcggagctgcca
ccacctatggagcgcacgggaggcattggggactcccgacccccatccttccaccctcat
gctggtgggggcagccaggagaacctggacaatgacacagagacggactctttggtgtct
gcccagcgagaacggccacgccggagggatggcccagagcatgcaacccggctaaatgga
actgcgaagggggaacggcggcgagaaccagggggttatgatagctcatccacccttatg
agcagcgagctggagaccaccagcttctttgactcagatgaggatgactccaccagcagg
ttcagcagctccacagaacagagcagcgcctcacgcctgatgagaagacacaagcggcgg
cggcggaagcagaaggtttctcggattgagcggtcttcatccttcagcagcatcacggac
tccaccatgtcactcaacatcatcacggtcactctcaacatggaaaaatataacttcttg
ggcatctccattgtgggccaaagcaatgagcgtggtgacggcggcatctacattggctct
atcatgaagggtggggccgtggctgctgatggacgcatcgagccaggagatatgctgtta
caggtaaacgagatcaactttgagaacatgagtaatgacgatgcagtccgggtactgcgg
gagattgtgcacaaaccggggcccatcaccctgactgtagccaagtgctgggacccaagt
ccacgtggttgcttcacattgcccaggagcgagcccatccggcccattgaccctgcagcc
tgggtctcccacactgcagccatgaccggcaccttccctgcatacggcatgagcccctcc
ctgagcaccatcacctccaccagctcctccatcaccagttccatccctgacacagagcgc
ctagacgacttccacttgtccatccacagtgacatggctgccatcgtaaaagccatggcc
tcccctgaatcagggttggaggtccgtgaccgcatgtggctcaagattaccatccctaat
gctttcatcggctcagatgtggtggactggctgtaccacaatgtggaaggcttcacggac
cggagggaggcccgcaagtatgccagcaacctgctgaaagctggcttcatccgccatacc
gtcaacaagatcaccttctccgagcagtgctactacatcttcggcgacctctgcggcaac
atggccaacctggctctccacgatcacgacggctccagtggcgcctctgaccaggacaca
ctggcccctttgccgcacccgggggccgccccttggcccatggctttcccataccagtac
ccgccacccccgcacccctacaacccgcacccgggcttcccggagctgggctacagctac
ggcgggggcagcgccagcagtcagcacagcgaaggcagtcggagcagtggctccaaccgt
agcggcagcgatcggaggaaggagaaggacccgaaggccggggactccaagtccgggggc
agcggcagcgaatcggaccacaccacacgcagcagcctgcgggggccgcgggagcgggcg
cccagcgagcgctcagggccggcggccagcgagcacagtcaccgcagccaccattccctg
gccagcagccttcgcagccaccacacacacccgagctacggccctcccggagtgccccct
ctctacggcccccccatgctgatgatgcccccgccgcccgcggccatggggcccccagga
gcccctccgggccgcgacctggcctcagtgcccccggaactgaccgccagcagacagtcc
ttccgcatggccatgggaaaccccaccaagaatttcgggctgtttgactttctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100454011
Entry
100454011         CDS       T01416                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X2
  KO
K02353  segment polarity protein dishevelled
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04330  Notch signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100454011 (DVL2)
   04330 Notch signaling pathway
    100454011 (DVL2)
   04390 Hippo signaling pathway
    100454011 (DVL2)
   04150 mTOR signaling pathway
    100454011 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100454011 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100454011 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454011 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100454011 (DVL2)
   05226 Gastric cancer
    100454011 (DVL2)
   05217 Basal cell carcinoma
    100454011 (DVL2)
   05224 Breast cancer
    100454011 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100454011 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100454011 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100454011 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100454011 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100454011
NCBI-ProteinID: XP_009249506
Ensembl: ENSPPYG00000007899
LinkDB
Position
17
AA seq 730 aa
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPL
PPERTSGIGDSRPPSFHHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLE
RHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPR
LERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVA
ADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLP
RNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIHTDMASV
TKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG
LIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSVNDNDGSSGASDQDTLAPLPGATPWP
LLPTFSYQYPAPHPYSPQPPPYHELSSYTCGGGSASSQHSEGSRSSGSTRSDGGAGRTGR
PEERAPESKSGSGSESEPSSRGGSLRRGGEPSGTSDGGPPPSRGSTGGAPNLRAHPGLHP
YGPPPGMALPYNPMMVVVMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMG
NPSEFFVDVM
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggcgggcagcagcactgggggcggtggggttggggagacgaaggtgatttaccacctg
gatgaggaagagactccctacctggtgaagatccctgtccccgccgagcgcatcaccctc
ggcgatttcaagagcgtcctgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggatttcggagtggtgaaggaagaaatttcagatgacaacgcccgcctcccctgc
ttcaacggaagggtggtatcctggctggtgtcctcagataatccccaacccgagatggcc
cctccagtccatgagcctcgggcagaactggcgcctccagccccacctttaccccctttg
ccacccgagaggaccagcggcattggggactcaaggcctccatccttccaccatgagaat
ctggagcctgagacagaaaccgagtcagtagtgtcactgaggcgggagcggcctcgcagg
agagacagcagtgagcatggcgctgggggccacaggactggtggcccctcaaggctggag
cgccacctggccggatacgagagctcctctaccctcatgaccagcgagctggagagtacc
agcctgggggactcggacgaggaggacaccatgagcaggttcagcagctccacggagcag
agcagtgcctcccgcctccttaagcgccaccggcggcgaaggaagcagcggccaccccgc
ctggagaggacgtcgtccttcagcagcgtcacagattccacaatgtctctcaatatcatc
acagtcacgctaaacatggagaagtacaacttcctgggtatctccattgtgggccaaagc
aatgagcggggagacggaggcatctacattggctccatcatgaagggtggggctgtggcg
gccgacgggcgcattgagccaggggacatgcttttgcaggtgaatgacatgaactttgag
aacatgagcaatgatgacgccgtgcgggtgctgagggacattgtgcataagcctggcccc
attgtgctgactgtggccaagtgctgggatccctctcctcaggcctatttcactctcccc
cgaaatgagcccatccagccaattgaccctgctgcctgggtgtcccattccgcggctctg
actggcaccttcccagcctatccaggctcctcctccatgagcaccattacatctggatcg
tctttgcctgatggctgtgaaggccggggtctctccatccatacagatatggcatcggtg
accaaggccatggcagctccagagtctggactggaagtccgggaccgcatgtggctcaag
atcaccatccctaatgcctttctgggctcggatgtggttgactggctctaccatcacgtg
gagggctttcctgagcggcgggaggcccgcaagtatgccagcgggctgctcaaagcaggc
ctgatccgacacaccgtcaacaagatcaccttctctgagcagtgctattacgtcttcgga
gacctcagtggtggctgtgagagctacctagtcaacctgtctgtcaatgacaacgatggc
tccagtggggcttcagaccaggacacgctggcccctctgcctggggccaccccctggccc
ctgctgcccactttctcctaccaataccctgcgccacacccctacagcccgcagcctccg
ccctaccatgagctttcatcttacacctgtggtgggggcagtgccagcagccagcacagt
gagggcagccggagcagtgggtcgacacggagcgatgggggggcagggcgcacggggagg
cctgaggagcgggcccccgagtccaagtccggcagtggcagtgagtccgagccctccagc
cgagggggcagccttcggcggggtggggaaccaagtgggactagcgatgggggccctcct
ccatccagaggctcaacggggggtgcccctaatctccgagcccacccagggctccatccc
tatggaccgccccctggcatggccctcccctacaaccccatgatggtggttgtgatgccc
ccacctccacctccagtccctccagcagtgcagcctccgggggcccctccagtcagagac
ctgggctctgtgcccccagaactgacagccagccgccaaagcttccacatggccatgggc
aatcccagcgagttctttgtggatgttatgtag

KEGG   Pongo abelii (Sumatran orangutan): 100454488
Entry
100454488         CDS       T01416                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04330  Notch signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100454488 (DVL1)
   04330 Notch signaling pathway
    100454488 (DVL1)
   04390 Hippo signaling pathway
    100454488 (DVL1)
   04150 mTOR signaling pathway
    100454488 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100454488 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100454488 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454488 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100454488 (DVL1)
   05226 Gastric cancer
    100454488 (DVL1)
   05217 Basal cell carcinoma
    100454488 (DVL1)
   05224 Breast cancer
    100454488 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100454488 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    100454488 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100454488 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100454488 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100454488
NCBI-ProteinID: XP_024111313
Ensembl: ENSPPYG00000002010
LinkDB
Position
1
AA seq 695 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSAST
ALSSELESSSFVDSEEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSI
TDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYAHVEGFKERREARKYASSLLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRVAGAGGS
GSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPMTKAYTVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcccccgagcgcgtcacgctagccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttctttaaatccatggaccaggacttcggggtggtgaag
gaggagatctttgatgacaacgccaagcttccctgcttcaacggccgcgtggtctcctgg
ctggtcctggctgagggtgctcactcagatgcagggtcccagggcacggacagccacaca
gacctgcccccgcccctcgagcggacaggcggcatcggggactctcggcccccttccttc
cacccaaatgtggccagcagccgtgacgggatggacaacgagacaggcacggagtccatg
gtcagccaccggcgggagcgtgcccgacgccggaaccgcgaggaggccgcccggaccaat
gggcacccaaggggagaccgacggcgggatgtggggctgcccccagacagcgcgtccacc
gccctaagcagtgagcttgagtccagcagctttgtggactcggaggaggatggcagcacg
agcaggctgagcagctccacggagcagagcacctcatccaggctcatccggaagcacaaa
cgccggcggaggaagcagcgccttcggcaggcggaccgggcctcctccttcagcagcata
accgactccaccatgtccctcaacatcgttactgtcacgctcaacatggagagacatcac
tttctgggcatcagcatcgtggggcagagcaacgaccgtggagacggcggcatctacatc
ggctccatcatgaagggcggggctgtggccgctgacggccgcatcgagccaggcgacatg
ttgctgcaggtgaatgacgtgaactttgagaacatgagcaatgatgatgccgtgcgggtg
ctgcgggagatcgtatcccagacggggcccatcagcctcactgtggccaagtgctgggac
ccaacgccccgaagctacttcactgtcccacgggctgacccggtgcggcccatcgacccc
gccgcctggctgtcccacacggcggcactgacaggagccctgccccgctacggtacgagc
ccctgctccagcgccgtcacgcgcaccagctcctcctcactaaccagctccgtgcctggt
gctccacagctggaagaggcgccgctgacggtgaagagtgacatgagcgccgtcgtccgg
gtcatgcagcttccagactcgggactggagatccgcgaccgcatgtggctcaagatcacc
atcgccaatgccgtcatcggggcggacgtggtggactggctgtacgcacacgtggagggc
ttcaaggagcgacgggaggcccggaagtacgccagcagcttgctgaagcacggcttcctg
cggcacacggtcaacaagatcaccttctccgagcagtgctactatgtcttcggggacctc
tgcagcaatctcgccaccctgaacctcaacagtggctccagtggggcttcggatcaggac
acgctggccccgctgccccacccggctgccccctggcccctgggtcagggctatccctac
cagtacccggggcccccaccctgcttcccgcctgcctaccaggacccgggctttagctat
ggcagcggcagcaccgggagtcagcagagtgaagggagcaagagcagcgggtccacccgg
agcagccgccgggccccgggccgtgagaaggagcgtcgggtggcgggagccgggggcagc
ggcagtgaatcggatcacacggcaccgagtggggtggggagcagctggcgagagcgtccg
gccggccagctcagccgcggcagcagcccgcgcagtcaggcctcggccaccgctccgggg
ctccccccgccccaccccatgaccaaggcctatacagtggtgggggggccgcctggggga
ccccctgtccgggagctggctgccgtccccccggaattgacaggcagccgccagtccttc
cagaaggccatggggaacccctgcgagttcttcgtggacatcatgtga

DBGET integrated database retrieval system