KEGG   Pongo abelii (Sumatran orangutan): 100448249
Entry
100448249         CDS       T01416                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04144  Endocytosis
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04350  TGF-beta signaling pathway
pon04371  Apelin signaling pathway
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04659  Th17 cell differentiation
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05161  Hepatitis B
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05220  Chronic myeloid leukemia
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100448249 (SMAD3)
   04350 TGF-beta signaling pathway
    100448249 (SMAD3)
   04390 Hippo signaling pathway
    100448249 (SMAD3)
   04371 Apelin signaling pathway
    100448249 (SMAD3)
   04068 FoxO signaling pathway
    100448249 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100448249 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100448249 (SMAD3)
   04218 Cellular senescence
    100448249 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100448249 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100448249 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100448249 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448249 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100448249 (SMAD3)
   05212 Pancreatic cancer
    100448249 (SMAD3)
   05225 Hepatocellular carcinoma
    100448249 (SMAD3)
   05226 Gastric cancer
    100448249 (SMAD3)
   05220 Chronic myeloid leukemia
    100448249 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100448249 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100448249 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100448249 (SMAD3)
   05161 Hepatitis B
    100448249 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100448249
NCBI-ProteinID: XP_002825631
Ensembl: ENSPPYG00000006583
UniProt: H2NNK3 A0A663DHH9
LinkDB
Position
15
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aaactcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaggggctccctcatgtcatctactgccgcctgtggcgatggccggacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatc
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagacccca
ccccctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacataataacttggac
ctgcagccagttacctactgcgagccagccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacattccacgcctcacagccatccatgactgtggatggcttc
accgatccctccaattcggagcgcttctgcctagggctgctctccaatgtcaacaggaat
gcagcagtggagctgacgcggagacacatcggaagaggcgtgcggctctactacatcgga
ggggaggtcttcgcagagtgcctcagtgacagcgctatttttgtccagtctcccaactgt
aaccagcgctatggctggcacccggccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggcccagtctgtcaaccagggcttt
gaggctgtctaccagttgacccgaatgtgcaccatccgcatgagctttgtcaaaggctgg
ggagcagaatacaggagacagactgtgaccagtaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system