KEGG   Pongo abelii (Sumatran orangutan): 100448360
Entry
100448360         CDS       T01416                                 

Gene name
EFNA1
Definition
(RefSeq) ephrin-A1
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448360 (EFNA1)
   04014 Ras signaling pathway
    100448360 (EFNA1)
   04015 Rap1 signaling pathway
    100448360 (EFNA1)
   04151 PI3K-Akt signaling pathway
    100448360 (EFNA1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100448360 (EFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100448360 (EFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448360 (EFNA1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448360 (EFNA1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100448360 (EFNA1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100448360 (EFNA1)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100448360
NCBI-ProteinID: XP_002810122
Ensembl: ENSPPYG00000000759
UniProt: H2N5I2 A0A663D7A2
LinkDB
Position
1
AA seq 205 aa
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
DAAMEQYILYLVEREEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG
HSAAPRLFPLAWTVLLLPLLLLQTP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggagttcctctgggcccctctcttgggtctgtgctgcagtctggccgctgctgatcgc
cacaccgtcttctggaacagttcaaatcccaagttccggaatgaggactacaccatacat
gtgcagctgaatgactacgtggacatcatctgtccgcactatgaggatcactctgtggca
gacgctgccatggagcagtacatactgtacctggtggagcgtgaggagtaccagctgtgc
cagccccagtccaaggaccaagtccgctggcagtgcaaccggcccagtgccaagcatggc
ccggagaaactgtctgagaagttccagcgcttcacacctttcaccctgggcaaggagttc
aaagaaggacacagctactactacatctccaaacccatccaccagcatgaagaccgctgc
ttgaggttgaaggtgactgtcagtggcaaaatcactcacagtcctcaggcccacgacaat
ccacaggagaagagacttgcagcagatgacccagaggtgcgggttctacatagcatcggt
cacagtgctgccccacgcctcttcccacttgcctggactgtgctgctcctgccacttctg
ctgctgcaaaccccgtga

KEGG   Pongo abelii (Sumatran orangutan): 100448970
Entry
100448970         CDS       T01416                                 

Gene name
EFNA3
Definition
(RefSeq) ephrin-A3 isoform X1
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448970 (EFNA3)
   04014 Ras signaling pathway
    100448970 (EFNA3)
   04015 Rap1 signaling pathway
    100448970 (EFNA3)
   04151 PI3K-Akt signaling pathway
    100448970 (EFNA3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100448970 (EFNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100448970 (EFNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448970 (EFNA3)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448970 (EFNA3)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100448970 (EFNA3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100448970 (EFNA3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100448970
NCBI-ProteinID: XP_002810124
Ensembl: ENSPPYG00000000760
UniProt: H2N5I3
LinkDB
Position
1
AA seq 238 aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVVYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggcggctccgttgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaagggcccggaggggcgctgggaaaccggcatgcggtgtactggaacagctcc
aaccagcacctgcggcgagagggctacaccgtgcaggtgaacgtgaacgactatctggat
atttactgcccgcactacaacagctcgggggtgggccccggggcggggccggggcccgga
ggcggggcagagcagtacgtggtgtacatggtgagccgcaacggctaccgcacctgcaac
gccagccagggcttcaagcgctgggagtgcaaccggccgcacgccccgcacagccccatc
aagttctcggagaagttccagcgctacagcgccttctcgctgggctacgagttccacgct
ggccacgagtactactacatctccacgcccactcacaacctgcactggaagtgtctgagg
atgaaggtgttcgtctgctgcgcctccacatcgcactccggggagaagccggtccccact
ctcccccagttcaccatgggccccaatgtgaagatcaacgtgctggaagactttgaggga
gagaaccctcaggtgcccaagcttgagaagagcatcagcgggaccagccccaaacgggaa
cacctgcccctggccgtgggcatcgccttcttcctcatgacgttcttggcctcctag

KEGG   Pongo abelii (Sumatran orangutan): 100449916
Entry
100449916         CDS       T01416                                 

Gene name
EFNA4
Definition
(RefSeq) ephrin-A4 isoform X2
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100449916 (EFNA4)
   04014 Ras signaling pathway
    100449916 (EFNA4)
   04015 Rap1 signaling pathway
    100449916 (EFNA4)
   04151 PI3K-Akt signaling pathway
    100449916 (EFNA4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100449916 (EFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100449916 (EFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100449916 (EFNA4)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100449916 (EFNA4)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100449916 (EFNA4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100449916 (EFNA4)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100449916
NCBI-ProteinID: XP_002810129
Ensembl: ENSPPYG00000000761
UniProt: H2N5I4
LinkDB
Position
1
AA seq 201 aa
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDT
PSPLCLLLLLLLLILRLLRIL
NT seq 606 nt   +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctg
cgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgctt
cgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccac
tatgaaggcccagggccccctgagggccccgagacgtttgctttatacatggtggactgg
ccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctcc
ctgccctttggccatgtccaattctcagagaagattcagcgcttcacacccttctccctc
ggctttgagttcttacctggagagacttactactacatctcggtgccaactccagagagt
tctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaagtctgagtca
gcccatcctgttgggagccctggagagagtggcacatcagggtggcgagggggggacact
cccagccccctctgtctcttgctattactgctgctcctgattcttcgtcttctgcgaatt
ctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100451193
Entry
100451193         CDS       T01416                                 

Gene name
EFNA5
Definition
(RefSeq) ephrin-A5
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100451193 (EFNA5)
   04014 Ras signaling pathway
    100451193 (EFNA5)
   04015 Rap1 signaling pathway
    100451193 (EFNA5)
   04151 PI3K-Akt signaling pathway
    100451193 (EFNA5)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100451193 (EFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100451193 (EFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100451193 (EFNA5)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100451193 (EFNA5)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100451193 (EFNA5)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100451193 (EFNA5)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100451193
NCBI-ProteinID: XP_002815814
Ensembl: ENSPPYG00000015670
UniProt: H2PG80 A0A6D2Y360
LinkDB
Position
5
AA seq 228 aa
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctggtgtttctggtgctctggatgtgtgtgttcagc
caggacccgggctccaaggccgtcgccgaccgctacgctgtctactggaacagcagcaac
cccagattccagaggggtgactaccatattgatgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactccgtcccagaagataagactgagcgctatgtcctgtac
atggtgaactttgatggctacagtgcctgcgaccacacttccaaagggttcaagagatgg
gaatgtaaccggcctcactctccaaatggaccactgaagttctctgaaaaattccagctc
ttcactcccttttctctaggatttgaattcaggccaggccgagaatatttctacatctcc
tctgcaatcccagataatggaagaaggtcctgtctaaagctcaaagtctttgtgagaccg
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggcgagaacgcggcacaaacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacattatag

KEGG   Pongo abelii (Sumatran orangutan): 112130075
Entry
112130075         CDS       T01416                                 

Gene name
EFNA2
Definition
(RefSeq) ephrin-A2
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112130075 (EFNA2)
   04014 Ras signaling pathway
    112130075 (EFNA2)
   04015 Rap1 signaling pathway
    112130075 (EFNA2)
   04151 PI3K-Akt signaling pathway
    112130075 (EFNA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    112130075 (EFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112130075 (EFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    112130075 (EFNA2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    112130075 (EFNA2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   112130075 (EFNA2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   112130075 (EFNA2)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 112130075
NCBI-ProteinID: XP_024092486
LinkDB
Position
19
AA seq 213 aa
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYT
VEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP
GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEA
PEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcgcccgcgcagcgcccgctgctcccgctgctgctcctgctgttaccgctgccgccg
ccgcccttcgcgcgcgccgaggacgccgcccgcgccaactcggaccgctacgccgtctac
tggaaccgcagcaaccccaggttccacgcaggcgcaggggacgacggcgggggctacacg
gtggaggtgagcatcaatgactacctggacatctactgcccgcactatggggcgccgctg
ccgccggccgagcgcatggagcactacgtgctgtacatggtcaacggcgagggccacgcc
tcctgcgaccaccgccagcgcggcttcaagcgctgggagtgcaaccggcccgccgcgccc
ggggggccgctcaagttctcggagaagttccagctcttcacgcccttctccctgggcttc
gagttccggcccggccacgagtattactacatttctgccacgcctcccaatgctgttgac
cggccttgcctgcgactgaaggtgtatgtgcggccgaccaacgagaccctgtacgaggct
cctgagcccatcttcaccagcaataactcgtgtagcagcccgggcggctgccgcctcttc
ctcagcaccatccccgtgctctggaccctcctgggttcctag

DBGET integrated database retrieval system