KEGG   Pongo abelii (Sumatran orangutan): 100448596
Entry
100448596         CDS       T01416                                 

Gene name
ST14
Definition
(RefSeq) suppressor of tumorigenicity 14 protein
  KO
K08670  suppressor of tumorigenicity protein 14 [EC:3.4.21.109]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100448596 (ST14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100448596 (ST14)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.109  matriptase
     100448596 (ST14)
Peptidases and inhibitors [BR:pon01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100448596 (ST14)
SSDB
Motif
Pfam: Trypsin CUB Ldl_recept_a SEA CUB_2 DUF1986
Other DBs
NCBI-GeneID: 100448596
NCBI-ProteinID: XP_002822743
Ensembl: ENSPPYG00000004066
UniProt: H2NFW2
LinkDB
Position
11
AA seq 855 aa
MGSDRARKGGGGPKDFGAGLKYSSRHEKVNGLEEGVEFLPVNNVKKVEKHGPGRWVVLAA
VLIGLLLVSLGIGFLVWHLQYRDVRVQKVFNGYMRITNENFVDAYENSNSTEFVSLASKV
KDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVM
LPPRARSLKSFVVTSVVAFPTDPKTVQRTQDNSCSFALHARGVELMRFTTPGFPDSPYPA
HARCQWALRGDADSVLSLTFRSFDLASCDERGSDLVMVYNTLSPMEPHALVQLCGTYPPS
YNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPKMGSCGGRLRKAQGTFNSPYYPGHY
PPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPTGTCPKDYVEINGEKYCGERSQFVVTS
NSNKITVRFHSDQSYTDTGFLAEYLSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDH
SDELNCSCDASHQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSNGKCLSK
SQQCNGKDDCGDGSDEVSCAKVNVVTCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEK
DCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYID
DRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKP
AEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYAGTGALILQKGEIRVINQTTCENLL
PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYT
RLPLFRDWIKEKTGV
NT seq 2568 nt   +upstreamnt  +downstreamnt
atggggagcgatcgggcccgcaagggcggagggggcccgaaggacttcggcgcgggactc
aagtacagctcgcggcacgagaaagtgaatggcttggaggaaggcgtggagttcctgccg
gtcaacaacgtcaagaaggtggaaaagcatggcccggggcgctgggtggtgctggcagcc
gtgctgatcggcctcctcttggtctcgctggggatcggcttcctggtgtggcatttgcag
taccgggacgtgcgtgtccagaaggtcttcaatggctacatgaggatcacaaatgagaat
tttgtggatgcctacgagaactccaactccactgagtttgtaagcctggccagcaaggtg
aaggacgcgctgaagctgctgtacagcggagtcccgttcctgggcccctaccacaaggag
tcggccgtgacggccttcagcgagggcagcgtcatcgcctactactggtctgagttcagt
atcccgcagcacctggtggaggaggccgagcgcgtcatggccgaggagcgcgtagtcatg
ctgcccccgcgggcgcgctccctgaagtcctttgtggtcacctcagtggtggctttcccc
actgaccccaaaacagtacagaggacccaggacaacagctgcagctttgccctgcacgcc
cgcggtgtggagctgatgcgcttcaccacgcccggcttccctgacagcccctaccccgct
catgcccgctgccagtgggccctgcggggagatgccgactcagtgctgagcctcaccttc
cgcagctttgaccttgcgtcctgtgatgagcgcggcagcgacctggtgatggtgtacaac
accctgagccccatggagccccacgccctggtgcagttgtgtggcacctaccctccctcc
tacaacctgaccttccactcctcccagaacgtcctgctcatcacactgatcaccaacacc
gagcggcggcatcccggcttcgaggccaccttcttccagctgcctaagatgggcagctgt
ggaggccgcttacgtaaagcccaggggacattcaacagcccctactacccaggccactac
ccacccaacattgactgcacgtggaacattgaggtgcccaacaaccagcatgtgaaggtg
cgcttcaaattcttctacctgctggagcccggcgtgcctacgggcacctgccccaaggac
tacgtggagatcaatggggagaagtactgcggagagaggtcccagttcgttgtcaccagc
aacagcaacaagatcacagttcgcttccactcagatcagtcctacactgacaccgggttc
ttagccgaatacctctcctacgactccagtgacccgtgcccggggcagttcacgtgccgc
acggggcggtgtatccggaaggagttgcgctgtgatggctgggccgactgcaccgaccac
agcgatgagctcaactgcagttgcgacgccagccaccagttcacctgcaagaacaagttc
tgcaagcccctcttctgggtgtgcgacagtgtgaacgactgcggagacaacagcgacgag
caggggtgcagttgtccagcccagaccttcaggtgttctaatgggaagtgcctctcgaag
agccagcagtgcaatgggaaggacgactgtggggacgggtccgacgaggtctcctgcgcc
aaggtgaacgtcgtcacttgtaccaaacacacctaccgctgcctcaatgggctctgcttg
agcaagggcaaccctgagtgtgacgggaaggaggactgtagcgacggctcagatgagaag
gactgtgactgtgggctgcggtcattcacgagacaggctcgtgttgttgggggcacggat
gcggatgagggcgagtggccctggcaggtgagcctgcacgctctgggccagggccacatc
tgcggtgcttccctcatctctcccaactggcttgtctccgccgcgcactgctacatcgat
gacagaggattcaggtactcagaccccacgcagtggacggcgttcctgggcttgcacgac
cagagccagcgcagcgcccccggggtgcaggagcgccggctcaagcgcatcatctcccac
cccttcttcaacgacttcaccttcgactatgacatcgcgctgctggagctggagaaaccg
gcggagtacagctccatggtgcggcccatctgcctgccggacgcctcccatgtcttccct
gccggcaaggctatctgggtcacgggctggggacacacccagtatgcaggcactggcgcg
ctgatcctgcaaaagggtgagatccgcgtcatcaaccagaccacctgcgagaacctcctg
ccgcagcagatcacgccgcgcatgatgtgcgtgggcttcctcagcggcggcgtggactcc
tgccagggtgattccgggggacccctgtccagcgtggaggcggatgggcggatcttccag
gccggtgtggtgagctggggagacggctgcgctcagaggaacaagccaggcgtgtacaca
aggctccctctgtttcgggactggatcaaagagaaaactggggtatag

DBGET integrated database retrieval system