KEGG   Pongo abelii (Sumatran orangutan): 100448769
Entry
100448769         CDS       T01416                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05219  Bladder cancer
pon05323  Rheumatoid arthritis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448769 (VEGFA)
   04014 Ras signaling pathway
    100448769 (VEGFA)
   04015 Rap1 signaling pathway
    100448769 (VEGFA)
   04370 VEGF signaling pathway
    100448769 (VEGFA)
   04066 HIF-1 signaling pathway
    100448769 (VEGFA)
   04020 Calcium signaling pathway
    100448769 (VEGFA)
   04151 PI3K-Akt signaling pathway
    100448769 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100448769 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100448769 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448769 (VEGFA)
   05206 MicroRNAs in cancer
    100448769 (VEGFA)
   05205 Proteoglycans in cancer
    100448769 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100448769 (VEGFA)
   05211 Renal cell carcinoma
    100448769 (VEGFA)
   05219 Bladder cancer
    100448769 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100448769 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100448769 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100448769 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100448769 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100448769 (VEGFA)
   05165 Human papillomavirus infection
    100448769 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100448769 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448769 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448769 (VEGFA)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100448769 (VEGFA)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100448769 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 100448769
NCBI-ProteinID: XP_024104065
LinkDB
Position
6
AA seq 215 aa
MNFLLSWVHWSFALLLYLHHAKWSQAAPMVEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaactttctgctgtcttgggtgcattggagctttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggtagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system