KEGG   Pongo abelii (Sumatran orangutan): 100449029
Entry
100449029         CDS       T01416                                 

Gene name
SOX4
Definition
(RefSeq) transcription factor SOX-4
  KO
K23581  transcription factor SOX4 (SOX group C)
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100449029 (SOX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100449029 (SOX4)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    100449029 (SOX4)
SSDB
Motif
Pfam: HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100449029
NCBI-ProteinID: XP_024103941
LinkDB
Position
6
AA seq 475 aa
MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIK
RPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHM
ADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGG
GGGASAGGANSKPAQKKNCGSKVAGGAGGGVSKPHAKLILAGGGGGGKAAAAAAAASFAA
EQAGAAALLPLGAAADHHSLYKARTPSASASASSAASASAALAAPGKHLAEKKVKRVYLF
GGLGTSSSPVGGVGAGADPSDPLGLYEEEGAGCSPDAPSLSGRSSAASSPAAGRSPADHR
GYASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSL
GSFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggtgcagcaaaccaacaatgccgagaacacggaagcgctgctggccggcgagagctcg
gactcgggcgccggcctcgagctgggaatcgcttcctcccccacgcccggttccaccgcc
tccacgggcggcaaggccgacgacccgagctggtgcaagaccccgagcgggcacatcaag
cggcccatgaacgccttcatggtgtggtcgcagatcgagcggcgcaagatcatggagcag
tcgcccgacatgcacaacgccgagatctccaagcggctgggcaaacgctggaagctgctc
aaagacagcgacaagatccctttcattcgagaggcggagcggctgcgcctcaagcacatg
gctgactaccccgactacaagtaccggcccaggaagaaggtgaagtccggcaacgccaac
tctagctcctcggccgccgcctcctccaagccgggggagaagggagacaaggtcggtggc
agcggcgggggcggccatgggggcggcggcggcggcgggagcagcaacgcggggggagga
ggcggcggtgcgagtgccggcggcgccaactccaaaccggcgcagaaaaagaactgcggc
tccaaagtggcgggcggcgcgggcggcggggtcagtaaaccgcacgccaagctcatcctg
gcaggcggcggcggcggcgggaaagcagcggctgccgccgccgccgcctccttcgccgcc
gaacaggcgggggccgccgccctgctgcccctgggcgccgccgccgaccaccactcgctg
tacaaggcgcggactcccagcgcctcggcctccgcctcctcggcagcctcggcctccgca
gcgctcgcggccccgggcaagcacctggcggagaagaaggtgaagcgcgtctacctgttt
ggcggcctgggcacgtcgtcgtcgcccgtgggcggcgtgggcgcgggagccgaccccagc
gaccccctgggcctgtacgaggaggagggcgcgggctgctcgcccgacgcgccgagcctg
agcggccgcagcagcgccgcctcgtcccccgccgccggccgctcgcccgccgaccaccgc
ggctacgccagcctgcgcgccgcctcgcccgccccgtccagcgcgccctcgcacgcgtcc
tcctcagcctcgtcccactcctcctcttcctcctcctcgggctcctcgtcctccgacgac
gagttcgaagacgacctgctcgacctgaaccccagctcaaactttgagagcatgtccctg
ggcagcttcagttcgtcgtcggcgctcgaccgggacctggattttaacttcgagcccggc
tccggctcgcacttcgagttcccggactactgcacgcccgaggtgagcgagatgatctcg
ggagactggctcgagtccagcatctccaacctggttttcacctactga

DBGET integrated database retrieval system