KEGG   Pongo abelii (Sumatran orangutan): 100449188
Entry
100449188         CDS       T01416                                 

Gene name
LRP5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05200  Pathways in cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100449188 (LRP5)
   04150 mTOR signaling pathway
    100449188 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100449188 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449188 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100449188 (LRP5)
   05226 Gastric cancer
    100449188 (LRP5)
   05224 Breast cancer
    100449188 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100449188 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    100449188 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100449188 (LRP5)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100449188 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD DUF5653
Other DBs
NCBI-GeneID: 100449188
NCBI-ProteinID: XP_024111320
LinkDB
Position
11
AA seq 1612 aa
MEAAPPGPPWPLVLLLLALCGCPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLE
DAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLY
WTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDG
STRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFAL
TLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFPTRCEEDN
GGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFT
DIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAV
DWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPK
IECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLED
KLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTN
PCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETN
NNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGM
AVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGK
PRIVRAFMDGTSCMTLVDKVGRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIAD
DLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGL
NDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMIPDD
QHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPD
RQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIIVNAERGYLYF
TNMQERAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSG
ANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHA
VEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQ
FACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADC
QDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAH
SSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGS
QHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPS
PATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYY
LDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 4839 nt   +upstreamnt  +downstreamnt
atggaggcagcgccgcccgggccgccgtggccgctggtgctgctgctgctggcgctgtgc
ggctgcccggcccccgccgcggcctcgccgctcctgctatttgccaaccgccgggacgta
cggctggtggacgccggcggagtcaagctggagtccaccatcgtggtcagtggcctggaa
gatgcggccgcagtggacttccagttctccaagggagccgtgtactggacagacgtgagc
gaggaggccatcaagcagacctacctgaaccagacgggggccgctgtgcagaacgtggtc
atctccggcctggtctctcccgatggcctcgcctgcgactgggtcggcaagaagctgtac
tggacggactcagagaccaaccgcatcgaggtggccaacctcaatggcacatcccggaag
gtgctcttctggcaggatcttgaccagccgagggccatcgccttggaccctgctcacggg
tacatgtactggacagactggggtgagacgccccggattgagcgggcagggatggacggc
agcacccggaagatcattgtggactcggacatttactggcccaatggactgaccatcgac
ctggaggagcagaagctctactgggccgacgccaagctcagcttcatccaccgtgccaac
ctggacggctcgttccggcagaaggtggtggagggcagcctgacgcacccctttgccctg
acgctgtccggggacactctgtactggacagactggcagacccgctccatccatgcctgc
aacaagcgcactggggggaagaggaaggagatcctgagcgccctctactcacccatggac
atccaggtgctgagccaggagcggcagcctttcttccccactcgctgtgaggaggacaat
ggcggctgctcccacctgtgcctgctatccccaagggagcctttctacacgtgcgcctgc
cccacgggtgtgcagctgcaggacaacggcaggacgtgtaaggcaggagccgaggaggtg
ctgctgctggcccggcggacggacctacggaggatctcgctggacacgccggacttcacc
gacatcgtgctgcaggtggacgacatccggcacgccattgccatcgactacgacccacta
gagggctacgtctactggacggatgatgaggtgcgggccatccgcagggcgtacctggac
gggtctggggcgcagacgctggtcaacaccgagatcaacgaccctgatggcatcgcagtc
gactgggtggcccgaaacctctactggaccgacacgggcacggaccgcatcgaggtgacg
cgcctcaatggcacctcccgcaagatcctggtgtcggaggacctggatgagccccgagcc
atcgcactgcaccccgtgatgggcctcatgtactggacagactggggagagaaccctaaa
atcgagtgtgccaacctggatgggcaggagcggcgtgtactggtcaatgcctcccttggg
tggcccaacggcctggccctggacctgcaggaagggaagctctactggggagacgccaag
acagacaagatcgaggtgatcaacgttgatgggacgaagaggcggaccctcctggaggac
aagctcccgcacattttcgggttcacgctgctgggggacttcatctactggactgactgg
cagcgccgcagcatcgagcgggtgcacaaggtcaaggccagccgggacgtcatcattgac
cagctgcccgacctgatggggctcaaagctgtgaacgtggccaaggtcgtcggaaccaac
ccgtgtgcggacaggaatggggggtgcagccacctgtgcttcttcacaccccacgcaacc
cggtgtggctgccccatcggcctggagctgctgagtgacatgaagacctgcatcgtgcct
gaggccttcttggtcttcaccagcagagccgccatccacaggatctccctcgagaccaac
aacaacgacgtggccatcccactcacgggcgtcaaggaggcctcagccctggactttgat
gtgtccaacaaccacatctactggacagacgtcagcctgaagaccatcagccgcgccttc
atgaacgggagctcggtggagcacgtggtggagtttggccttgactaccctgagggcatg
gccgttgactggatgggcaagaacctctactgggccgacaccgggaccaacaggatcgaa
gtggcgcggctggacgggcagttccggcaagtcctcgtgtggagggacttggacaacccg
aggtcactggccctggatcccaccaagggctacatctactggaccgagtggggcggcaag
ccgaggatcgtgcgggccttcatggacgggaccagctgcatgacgctggtggacaaggtg
ggccgggccaacgacctcaccattgactatacagaccaacgcctctactggaccgacctg
gacaccaacatgatcgagtcgtccaacatgctgggtcaggagcgggtcgtgattgccgac
gatctcccgcacccattcggtctgacgcagtacagtgattatatctactggacggactgg
aatctgcacagcattgagcgggccgacaagaccagtggccggaaccgcaccctcatccag
ggccacctggacttcgtgatggacatcctggtgttccactcctcccgccaggatggcctc
aatgactgtatgcacaacaacgggcagtgtgggcagctgtgccttgccatccctggcggc
caccgctgcggctgcgcctcacactacaccctggaccccagcagccgcaactgcagcccg
cccaccaccttcttgctgttcagccagaaatctgccatcagtcggatgatcccggacgac
cagcacagcccggatctcatcctgcccctgcatgggctgaggaacgtcaaagccatcgac
tatgacccactggacaagttcatctactgggtggacgggcgccagaacatcaagcgagcc
aaggacgacgggacccagccctttgttttgacctctctgagccaaggccaaaacccagac
aggcagccccacgacctcagcatcgacatctacagccggacgctgttctggacgtgcgag
gccaccaataccatcaacgtccacaggctgagcggggaagccatgggggtggtgctgcgt
ggggaccgcgacaagcccagggccatcatcgtcaacgcagagcgagggtacctgtacttc
accaacatgcaggagcgggcagccaagatcgaacgcgcggccctggacggcaccgagcgc
gaggtcctcttcaccactggcctcatccgccctgtggccctggtggtggacaacacactg
ggcaagctcttctgggtggacgcggacctgaagcgcattgagagctgcgacctgtcaggg
gccaaccgcctgaccctggaggacgccaacatcgtgcagcctctgggcctgaccgtcctt
ggcaagcacctctactggatcgaccgccagcagcagatgatcgagcgtgtggagaagacc
actggggacaagcggactcgcgtccagggccgcgtcgcccacctcactggcatccacgcg
gtggaggaagtcagcctggaggagttctccgcccacccatgtgcccgtgacaatggtggc
tgctcccacatctgtattgccaagggtgatgggacaccacggtgctcatgcccagtccac
ctcgtgctcctgcagaacctgctgacctgtggagagccgcccacctgctccccggaccag
ttcgcatgtgcaacgggggagatcgactgtatccctggggcctggcgctgtgacggcttt
cccgagtgtgacgaccagagcgacgaggagggctgccccgtgtgctccgctgcccagttc
ccctgcgcgcggggccagtgtgtggacctgcgcctgcgctgcgatggtgaggccgactgt
caggaccgctcagatgaggcggactgtgacgccatctgcctgcccaaccagttccggtgt
gccagcggccagtgtgtccttatcaagcagcagtgcgactccttccccgactgtatcgat
ggctccgacgagctcatgtgtgaaatcaccaagccgccctcagacgacagcccggcccac
agcagtgccatcgggcccgtcattggcatcatcctctccctcttcgtcatgggtggtgtc
tattttgtgtgccagcgcgtggtgtgccagcgctacgcgggggccaacgggcccttcccg
cacgagtatgtcagcgggaccccgcacgtgcccctcaatttcatagccccaggcggttcc
cagcatggccccttcacaggcatcgcatgcggaaagtccatgatgagctccgtgagcctg
atggggggccggggcggggtgcccctctacgaccggaaccacgtcacaggggcctcgtcc
agcagctcgtccagcacgaaggccacgctgtacccgccgatcctgaacccgccgccctcc
ccggccacggacccctccctgtacaacatggacatgttctactcttcaaacattccggcc
actgcgagaccatacaggccctacatcattcgaggaatggcgcccccgacgacgccctgc
agcaccgacgtgtgtgacagcgactacagcgccagccgctggaaggccagcaaatactac
ctggatttgaactcggactcagacccctacccgcccccacccacgccccacagccagtac
ctgtcggcagaggacagctgcccgccctcgcccgccaccgagagaagctacttccatctc
ttcccgccccctccgtccccctgcacggactcatcctga

KEGG   Pongo abelii (Sumatran orangutan): 100452008
Entry
100452008         CDS       T01416                                 

Gene name
LRP6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05200  Pathways in cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100452008 (LRP6)
   04150 mTOR signaling pathway
    100452008 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100452008 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452008 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100452008 (LRP6)
   05226 Gastric cancer
    100452008 (LRP6)
   05224 Breast cancer
    100452008 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452008 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    100452008 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100452008 (LRP6)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100452008 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 100452008
NCBI-ProteinID: XP_024112649
LinkDB
Position
12
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
SHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWT
DWSTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAVNRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGAFRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagcttctgtgtgcttctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
agtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagaattt
aacaaaactgagagtgtacagaatgttgttgtttctggattattgtcccccgatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattataataaacagtgaa
atttactggccaaatggactgactttggattatgaagaacaaaagctttattgggcagat
gcaaaacttaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacatattatactggact
gactggagcacacactccattttggcttgcaacaagtatactggtgagggtctgcgtgaa
atccattctaacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgccacaaatccatgtggaattgacaatgggggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgccccactggggtcaaactcctggagaatgga
aaaacctgcaaagatggtgccacagaattattgcttttagctcgaaggacagacttgaga
cgcatttctttggatacaccagattttacagacattgttctgcagttagaagacatccgt
catgccattgccatagattacgatcctgtggaaggctacatctactggactgatgatgaa
gtgagggccatacgccgttcatttatagatggatctggcagtcagtttgtggtcactgct
caaattgcccatcctgatggtattgctgtggactgggttgcacgaaatctttattggacc
gacactggcactgatcgaatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaattccgaaaattgagcgagcagctctggatggttctgac
cgtgtagtattggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaagattgaggttatgaatactgat
ggcactgggagacgagtactagtggaagacaaaattcctcacatatttggatttactttg
ttgggtgactatgtttactggactgactggcagaggcgtagcattgaaagagttcataaa
cgaagtgcagagagggaagtgatcatagatcagctgcctgacctcatgggcctaaaagcc
acaaatgttcatcgagtgattggttccaacccctgcgctgaggaaaatgggggatgtagc
catctctgcctctatagacctcagggccttcgctgtgcttgccctattggctttgaactc
atcagtgacatgaagacctgcattgtcccagaggctttccttttattttcacggagagca
gatatcagacgaatttctttggaaacaaacaataataatgtggctattccactcactggt
gtcaaagaagcttctgctttggattttgatgtgacagacaaccgaatttattggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacatgtggta
gaattcggcttagattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacaggaacgaatcgaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacctagatagtcccagagctctcgcgttggaccctgccgaagga
tttatgtattggactgaatggggtggaaagcctaagatagacagagctgcaatggatgga
agtgaacgtactaccttagttccaaatgtggggcgggcaaacggcctaactattgattat
gctaaaaggaggctttattggacagacctggacaccaacttaatagaatcttcaaatatg
cttgggctcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattatatctactggacggactggagccgacgcagcattgagcgtgccaacaaa
accagtggccaaaaccgcaccatcattcagggccatttggattatgtgatggacatcctc
gtctttcactcatctcgacagtcagggtggaatgaatgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttgggggttttgtttgtggatgccctgcccactac
tctcttaatgctgacaacaggacttgtagtgctcctaccactttcctgctcttcagtcaa
aagagtgccgtcaaccgcatggtgattgatgaacaacagagccccgacatcatccttccc
atccacagccttcggaatgtccgggccattgactatgacccactggacaagcaactctat
tggattgactcacgacaaaacatgatccgaaaggcacaagaagatggcagccagggcttt
actgtggttgtgagctcagttccgagtcagaacctggaaatacaaccctatgacctcagc
attgatatttatagccgctacatctactggacttgtgaggctaccaatgtcattaatgtg
acaagattagatgggagatcagttggagtggtgctaaaaggcgagcaggacagacctcga
gccattgtggtaaacccagagaaagggtatatgtattttaccaatcttcaggaaaggtct
cctaaaattgaacgggctgctttggatgggacagaacgggaggtcctctttttcagtggc
ttaagtaaaccaattgctttagcccttgatagcaggctgggcaagctcttttgggctgat
tcagatctccggcgaattgaaagcagtgatctctcaggtgctaaccggatagtattagaa
gactccaatatcttgcagcctgtgggacttactgtgtttgaaaactggctctattggatt
gataaacagcagcaaatgattgaaaaaattgacatgacaggtcgagagggtagaaccaaa
gtccaagctcgaattgctcagcttagtgacattcatgcagtaaaggagctgaaccttcaa
gaatacagacagcacccttgtgctcaggataatggtggctgttcacatatttgtcttgta
aagggggatggtactacaaggtgttcttgtcccatgcacctggttctgcttcaagatgag
ctatcatgtggagaacctccaacatgttctcctcagcagtttacttgtttcacgggggag
attgactgtatccctgtggcttggcggtgcgatgggtttactgaatgtgaagaccacagt
gatgaactcaattgtcctgtatgctcagagtcccagttccagtgtgccagtgggcagtgt
attgatggtgccttccgatgcaatggagatgcaaactgccaggacaaatcagatgagaag
aattgtgaagtgctttgtttaattgatcaattccgttgtgccaatggtcagtgcattgga
aagcacaagaagtgtgatcataatgtggattgcagtgacaagtcagatgaactggattgt
tatccaactgaagaaccagcaccacaggccaccaatacagttggttctgttattggtgta
attgtcaccatttttgtgtctggaactatatactttatctgccagaggatgttgtgtcca
cgtatgaagggagatggggaaactatgactaatgactatgtagttcatggaccagcttct
gtgcctcttggttatgtgccacacccaagttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgatcagctccctcagtatcatggggggaagcagtggacccccctat
gaccgagcccatgttacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
ttccctgcaattttgaaccctccaccatccccagccacagagcgatcacattacactatg
gaatttggatattcttcaaacagtccttccactcataggtcatacagctacaggccatat
agctaccggcactttgcaccccccaccacaccctgcagcacagatgtttgtgacagtgac
tatgctcctagtcggagaatgacctcagtggcaacagccaagggctataccagtgacttg
aactatgattcagaacctgtgcccccacctcccacaccccgaagccaatacttgtcagca
gaggagaactatgaaagctgcccaccttctccatacacagagaggagctattctcatcac
ctctacccaccgccaccctctccctgtacagactcctcctga

DBGET integrated database retrieval system