KEGG   Pongo abelii (Sumatran orangutan): 100449704
Entry
100449704         CDS       T01416                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04810  Regulation of actin cytoskeleton
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05146  Amoebiasis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100449704 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100449704 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100449704 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100449704 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449704 (FN1)
   05205 Proteoglycans in cancer
    100449704 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100449704 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100449704 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100449704 (FN1)
   05100 Bacterial invasion of epithelial cells
    100449704 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100449704 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100449704 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100449704 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100449704 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100449704 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100449704 (FN1)
Membrane trafficking [BR:pon04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    100449704 (FN1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100449704 (FN1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100449704 (FN1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   100449704 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369
Other DBs
NCBI-GeneID: 100449704
NCBI-ProteinID: XP_009236347
Ensembl: ENSPPYG00000013148
LinkDB
Position
2B
AA seq 2477 aa
MLRGPGPGLLLLAVLCLGTAVPSTAASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPFSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATG
IFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHLSGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPSNGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSSPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE
NT seq 7434 nt   +upstreamnt  +downstreamnt
atgctcaggggtccggggcccgggctgctgctgctggccgtcctgtgcctggggacagcg
gtgccctccactgcagcctcgaagagcaagaggcaggctcagcaaatggttcagccccag
tccccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacactatcag
ataaatcaacagtgggagcggacctacctgggcaatgccttggtttgtacttgttatgga
ggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgctttgacaag
tacactgggaacacttaccgagtgggtgacacttatgagcgtcctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaataagctgtaccattgcaaaccgc
tgccatgaagggggtcagtcctacaagattggggacacctggaggagaccacatgagact
ggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacctgcaag
cccatagctgagaagtgttttgatcatgctgctgggacttcctatgtggttggagaaacc
tgggaaaagccctaccaaggctggatgatggtggattgtacttgtttgggagaaggcagc
ggacgcatcacttgcacctctagaaatagatgcaacgatcaggacacaaggacatcctat
agaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgcatctgc
acaggcaacggccgaggagagtggaagtgtgaaaggcacacctctgtgcagaccacatca
agcggatctggccccttcactgatgttcgtgcagctgtttaccaaccgcagcctcacccc
cagcctcctccctatggtcactgtgtcacagacagtggtgtggtctactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcatgtgcctgggcaacggagtc
agctgccaagagacagctgtaacccagacttatggtggcaactcaaatggagagccatgt
gtcttaccattcacctacaatggcaggacgttctactcctgcaccacagaagggcgacag
gatggacatctttggtgcagcacaacttcgaattatgagcaggaccagaaatattctttc
tgcacagaccacactgttttggttcagactcgaggaggaaattccaatggtgccttgtgt
cacttccccttcctatacaacaaccacaattacactgattgcacttctgagggcagaaga
gacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagtttgggttc
tgccccatggctgcccatgaggaaatctgcacaaccaatgaaggggtcatgtaccgcatt
ggagatcagtgggataagcagcatgacatgggtcacatgatgaggtgcacgtgtgttggg
aacggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgcattgtt
gatgacatcacttacaatgtgaatgacacattccacaagcgtcatgaagaggggcacatg
ctgaactgtacatgcttcggtcagggtcggggaagatggaagtgtgatcccgtcgaccaa
tgccaggattcagagactgggacgttttatcaaattggagattcatgggagaagtatgtg
catggtgtcagataccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttacagacctatccaagctcaagtggtcctgtcgaagtatttatcactgaaactccg
agtcagcccaactcccaccccatccagtggaatgcaccacagccatctcacatttccaag
tacattctcaggtggagacctaaaaattctgtaggccgttggaaggaagctaccatacca
ggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgagggccag
ctcatcagcatccagcagtacggccaccgagaagtgactcgctttgacttcaccaccacc
agcaccagcacacctgtgaccagcaacaccgtgacaggagagacaactcccttttctccc
gttgtggccacttctgaatctgtgaccgaaatcacagccagcagctttgtggtctcctgg
gtctcagcttctgacaccgtgtcgggattccgggtggaatatgagctgagtgaggaggga
gatgagccacagtacctggatcttccaagcacagccacttccgtgaacatccctgacctg
cttcctggccgaaaatacattgtaaatgtctatcagatatctgaggatggggagcagagt
ttgatcctgtctacttcacaaacaacagcgcccgatgcccctcctgacccgactgtggac
caagttgatgacacctcaattgttgttcgctggagcagaccccaggctcccatcacaggg
tacagaatagtctattcaccatcagtagaaggtagcagcacagaactcaaccttcctgaa
actgcaaactccgtcaccctcagtgatttgcaacctggtgttcagtataacatcactatc
tatgctgtggaagaaaatcaagaaagtacacctgttgtcattcaacaagaaaccactggc
accccacgctcagatacagtgccctctcccagggacctgcagtttgtggaagtgacagat
gtgaaggtcaccatcatgtggacaccgcctgagagtgcagtgaccggctaccgcgtggat
gtcatccctgtcaacctgcctggcgagcacgggcagaggctgcccatcagcaggaacacc
tttgcagaagtcaccgggctgtcccctggggtcacctattacttcaaagtctttgcagtg
aaccacgggagggagagcaagcctctgactgctcaacagacaaccaaactggatgctccc
actaacctccagtttgtcaatgaaactgattctactgtcctggtgagatggactccacct
cgggcccagataacaggataccgactgaccgtgggcctgacccgaagaggccagcccagg
cagtacaatgtgggtccctctgtctccaagtacccactgaggaatctgcagcctggatct
gagtacaccgtatccctcgtggccataaagggcaaccaagagagccccaaagccactgga
atctttaccacactgcagcctgggagctctattccaccttacaacaccgaggtgactgag
accaccattgtgatcacatggacgcctgctccaagaattggttttaagctgggtgtacga
ccaagccagggaggagaggcaccaagagaagtgacttcagactcagggagcatcgttgtg
tctggcttgactccaggagtggaatacgtctacaccatccaagtcctgagagacggacag
gaaagagatgcgccaattgtaaacaaagtggtaacaccattgtctccaccaacaaacttg
catctggaggcaaaccctgacactggagtgctcacagtctcctgggagaggagcaccacc
ccagacattactggttatagaattaccacaacccctacaaacggccagcagggatattct
ttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagtcccggc
ctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagtcacagggctggagccgggcattgactatgatatcagcgttatcact
ctcattaatggcggcgagagtgcccctactacactgacacaacaaacggctgttcctcct
cccactgacctgcgattcaccaacattggtccagacaccatgcgtgtcacctgggctcca
cccccatccattgatttgaccaacttcctggtgcgttactcacctgtgaaaaatgaggaa
gatgttgcagagttgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctggtacagaatatgtagtgagtgtctccagtgtctatgaacaacacgagagcacacct
cttagaggaagacagaaaacaggtcttgattccccaactggtattgacttttctgatatt
accgccaactcttttactgtgcactggattgctcctcgagccaccatcactggttacagg
atccgccatcatcccgagcaccttagtgggagacctcgagaagatcgggtgcccccctct
cggaattccatcaccctcaccaacctcactccgggcacagagtatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcccttattgattggccaacaatcaacagtttctgat
gttccaagggacctggaagttgttgctgcgacccccaccagcctactgatcagctgggat
gctcctgctgtcacagtgagatattacaggatcacttatggagaaacaggaggaaatagc
cctgtccaggagttcactgtgcctgggagcaagtctacagctaccatcagtggccttaaa
cctggagttgattataccatcactgtgtatgctgtcactggccgtggagacagccccgcg
agcagcaagccaatttccattaattaccgaacagaaattgacaaaccatcccagatgcaa
gtgaccgatgttcaggacaacagcattagtgtcaagtggctgccttcaagttcccctgtt
actggttacagagtaaccaccactcccaaaaatggaccaggaccaacaaaaactaaaact
gcaggtccagatcaaacagaaatgactattgaaggcttgcagcccacagtggagtatgtg
gttagtgtctatgctcagaatccaagcggagagagtcagcctctggttcagactgcagta
accaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcagaccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagctattcctgcaccaactgacctgaag
ttcactcaagtcacacccacgagcctgagcgcccagtggacaccacccaatgttcagctc
actggatatagagtgcgggtgacccccaaggagaagaccggaccaatgaaagaaatcaac
cttgctcctgacagctcatccgtggttgtatcaggacttatggtggccaccaaatatgaa
gtgagtgtctatgctcttaaggacactttgacaagcagaccagctcagggagttgtcacc
actctggagaatgtcagcccaccaagaagggctcgtgtgacagatgctactgagaccacc
atcaccattagctggagaaccaagaccgagacgatcactggcttccaagttgatgctgtt
ccatccaatggccagactcctatccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttacaaccaggcactgactacaagatctacctgtacaccttgaacgacaat
gcccggagctcccctgtggtcatcgacgcctccactgccattgatgcgccatccaacctg
cgtttcctggccaccacacccaattccttgctggtatcatggcagccgccacgtgccagg
attaccggctacatcatcaagtatgagaagcctgggtcttctcccagagaagtggtccct
cggccccgccctggtgtcacagaggctactattactggcctggaaccgggaaccgaatat
acaatttatgtcattgccctgaagaataatcagaagagcgagcccctgattggaaggaaa
aagacagacgagcttccccaactggtaacccttccacaccccaatcttcatggaccagag
atcttggatgttccttccacagttcaaaagacccctttcgtcacccaccctgggtatgac
actggaaatggtattcagcttcctggcacttctggtcagcaacccagtgttgggcaacaa
atgatctttgaggaacatggttttaggcggaccacaccgcccacaacggccacccccata
aggcataggccaagaccatacccgccgaatgtaggtgaggagatccaaattggtcacatc
cccagggaagatgtagactatcacctctacccacatggtccgggactcaatccaaatgcc
tctacaggacaagaagctctctctcagacaaccatctcatgggccccattccaggacact
tctgagtacatcatttcatgtcatcctgttggcaccgatgaagaacccttacagttcagg
gttcctggaacttctaccagtgccactctgacaggcctcaccagaggtgccacctacaac
atcatagtggaggcactgaaagaccagcagaggcataaggttcgggaagaggttgttacc
gtgggcaactctgtcaacgaaggcttgaaccaacctacggatgactcgtgctttgacccc
tacacagtttcccattatgccgttggagatgagtgggaacgaatgtctgaatcaggcttt
aaactgttgtgccagtgcttaggctttggaagtggtcatttcagatgtgattcatctaga
tggtgccatgacaatggtgtgaactacaagattggagagaagtgggaccgtcagggagaa
aatggccagatgatgagctgcacgtgtcttgggaacggaaaaggagaattcaagtgtgac
cctcatgaggcaacgtgttatgatgatgggaagacgtaccacgtaggagaacagtggcag
aaggaatatctcggtgccatttgctcctgcacatgctttggaggccagcggggctggcgc
tgtgacaactgccgcagacctggcggtgaacccagtcccgaaggcactactggccagtcc
tacaaccagtattctcagagataccatcagagaacaaacactaatgttaattgcccaatt
gaatgcttcatgcctttagatgtacaggctgacagagaagattcccgagagtaa

DBGET integrated database retrieval system