KEGG   Pongo abelii (Sumatran orangutan): 100449905
Entry
100449905         CDS       T01416                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04151  PI3K-Akt signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing syndrome
pon05162  Measles
pon05165  Human papillomavirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05215  Prostate cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100449905 (CDKN1B)
   04066 HIF-1 signaling pathway
    100449905 (CDKN1B)
   04068 FoxO signaling pathway
    100449905 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100449905 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100449905 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449905 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100449905 (CDKN1B)
   05206 MicroRNAs in cancer
    100449905 (CDKN1B)
   05203 Viral carcinogenesis
    100449905 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100449905 (CDKN1B)
   05220 Chronic myeloid leukemia
    100449905 (CDKN1B)
   05215 Prostate cancer
    100449905 (CDKN1B)
   05222 Small cell lung cancer
    100449905 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100449905 (CDKN1B)
   04934 Cushing syndrome
    100449905 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100449905 (CDKN1B)
   05169 Epstein-Barr virus infection
    100449905 (CDKN1B)
   05165 Human papillomavirus infection
    100449905 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100449905 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 100449905
NCBI-ProteinID: XP_002822998
Ensembl: ENSPPYG00000004307
UniProt: A0A6D2XGE9 H2NGN0
LinkDB
Position
12
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaaacccttagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacctccgcggccccccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc
cagacggggttagcggagcagtgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system