KEGG   Pongo abelii (Sumatran orangutan): 100450045
Entry
100450045         CDS       T01416                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04024  cAMP signaling pathway
pon04260  Cardiac muscle contraction
pon04261  Adrenergic signaling in cardiomyocytes
pon04371  Apelin signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04919  Thyroid hormone signaling pathway
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100450045 (SLC9A1)
   04024 cAMP signaling pathway
    100450045 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100450045 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100450045 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100450045 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    100450045 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    100450045 (SLC9A1)
   04971 Gastric acid secretion
    100450045 (SLC9A1)
   04972 Pancreatic secretion
    100450045 (SLC9A1)
   04976 Bile secretion
    100450045 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100450045 (SLC9A1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100450045 (SLC9A1)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   100450045 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 100450045
NCBI-ProteinID: XP_009231499
LinkDB
Position
1
AA seq 815 aa
MVLRSGICGLSPPRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDV
TTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFV
VALGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPSERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITID
PASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTP
APSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggttctgcggtctggcatctgtggcctctctccacctcggatcttcccttccttgctc
gtggtggtcgctttggtggggctgctgcctgttctcaggagccatggcctccagctcagc
ccaactgccagcaccattcgaagctcagagccaccacgagaacgctcgattggggatgtc
accaccgctccaccggaggtcaccccagagagccgccctgttaatcattccgtcactgat
catggcatgaagccgcgcaaggcctttccagtcctgggcatcgactacacgcacgtgcgc
acccccttcgagatctccctctggatccttctggcctgcctcatgaagataggtttccat
gtgatccccactatctcaagcatcgtcccggagagctgcctgctgatcgtggtggggctg
ctggtggggggcctgatcaagggtgtaggcgagacaccccccttcctgcaatccgacgtc
ttcttcctcttcctgctgccgcccatcatcctggacgcgggctacttcctgccactgcgg
cagttcacagaaaacctgggcaccatcctgatctttgccgtggtgggcacgctgtggaac
gccttcttcctgggcggactcatgtacgccgtgtgcctggtgggcggtgaacagatcaac
aacatcggcctcctggacaacctgctcttcggcagcatcatctcggccgtggaccccgtg
gcggttctggctgtctttgaggaaattcacatcaatgagctgctgcacatccttgttttt
ggggagtccttgctcaatgacgccgtcactgtggtcctgtatcacctctttgaggagttt
gccaactacgaacacgtgggcatcgtggacatcttccttggcttcctgagcttcttcgtg
gtggccctgggcggggtgtttgtgggcgtggtctacggggtcatcgcagccttcacctcc
cgatttacctcccacatccgcgtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacttgtcagccgagctcttccacctgtcaggcatcatggcgctcatagcctcggga
gtggtgatgcgcccctatgtggaggccaacatctcccacaagtcccacaccaccatcaaa
tacttcctgaagatgtggagcagcgtcagcgagaccctcatcttcatcttcctcggcgtc
tccacagtggccggctcccaccactggaactggaccttcgtcatcagcaccctgctcttc
tgcctcatcgcccgcgtgctgggggtgctgggcctgacctggttcatcaacaagttccgt
atcgtgaagctgacccccaaggaccagttcatcatcgcctatgggggcctgcgaggggcc
atcgccttctctctgggctacctcctggacaagaagcacttccccatgtgtgacctgttc
ctcactgccatcatcaccgtcatcttcttcaccgtctttgtgcagggcatgaccattcgg
cccctggtagacttgttggctgtgaagaaaaagcaagaaacgaagcgctccatcaacgaa
gagatccacacacagttcctggaccaccttctgacaggcatcgaggacatctgtggccac
tacggtcaccaccactggaaggacaagctcaaccggtttaataagaaatacgtgaagaag
tgtctgatagccggcgagcgctccaaggagccccagctcatcgccttctaccataagatg
gagatgaagcaggccatcgagctggtggagagcgggggcatgggcaagatcccctctgcc
gtctccaccgtctccatgcagaacatccaccccaagtccctgccttccgagcgcatcctg
ccggcactgtccaaggacaaggaggaggagatccgcaaaatcctgaggaacaacttgcag
aagactaggcagcggctgcggtcctacaacagacacacactggtggcagacccctacgag
gaagcctggaaccagatgctgctccggaggcagaaggcccggcagctggagcagaagatc
aacaactacctgacggtgccagcccacaagctggactcacccaccatgtctcgggcccgc
atcggctcagacccactggcctatgagccgaaggaggacctgcctgtcatcaccatcgac
ccggcttccccgcagtcacccgagtctgtggacttggtgaacgaggagctgaagggcaaa
gtcttggggttgagccgggatcctgcaaaggtggccgaggaggacgaggacgacgatggg
ggcatcatgatgcggagcaaggagacttcgtccccaggaaccgacgatgtcttcacccct
gcgcccagtgacagccccagctcccagaggatacagcgctgcctcagtgacccaggcccg
caccctgagcctggggagggagaaccgttcatccccaaggggcagtag

DBGET integrated database retrieval system