KEGG   Pongo abelii (Sumatran orangutan): 100450054
Entry
100450054         CDS       T01416                                 

Gene name
MAP3K2
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04540  Gap junction
pon04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450054 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100450054 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100450054 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100450054 (MAP3K2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100450054 (MAP3K2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE11 family
   100450054 (MAP3K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 100450054
NCBI-ProteinID: XP_009235899
Ensembl: ENSPPYG00000012768
UniProt: A0A2J8VLY3
LinkDB
Position
2B
AA seq 619 aa
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFP
RPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
INGSTQATNLEPLPSLEDLDNTVFGAERKKRLPIIGHTSRDRSSPPPGYIPDELHQVARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVS
FSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKQIFVE
AKLRPSADELLRHMFVHYH
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggatgatcagcaagctttgaactcaatcatgcaagatttggctgtccttcataaggcc
agtcgaccagcattatccttgcaggaaaccagaaaagcaaaatcttcatcaccaaaaaaa
cagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttcccc
agaccagttaaactggaagatctgagatctaaagctaaaattgcctttggacagtctatg
gatctacattataccaataacgagttggtaattccattaactactcaagatgacttggac
aaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagatattacttgta
ataaatggaagtacacaggctactaatttagaaccattgccatcactagaagatttggat
aatacagtatttggtgcagagaggaaaaaacggcttcctataataggtcatactagtaga
gatagaagttctcctcccccaggatacattccagatgaattacaccaggttgcccggaat
gggtcattcactagtatcaacagtgaaggagagttcattccagagagcatggaccaaatg
ctggatccattatctttaagcagccctgaaaattctggctcaggaagttgtccatcactt
gatagtcctttggatggagagagctatccaaaatcacgaatgcctagggcacagagctac
ccagataatcatcaggaattttcagactatgataaccctatctttgagaaatttggaaaa
ggaggaacatatccaagaaggtatcatgtttcatatcatcatcaagagtataatgatggt
cgtaaaacttttccaagagctagaaggacccaggggaccagcttacggtctcctgtgagt
ttcagtcctactgatcattccttaagcactagtagtggaagcagtatctttaccccagag
tatgatgatagtcgaataagaagaaggggaagtgacatagacaatcctactttgaccgta
atggacatcagcccacccagccgttcacctcgagctccgaccaactggagattgggcaaa
ctgcttggccagggagcctttggaagggtctacctctgttatgatgttgatacaggaaga
gaattggctgttaagcaagttcaatttgatcccgacagtcctgagaccagcaaggaagta
aatgcacttgagtgtgaaattcagttgctgaaaaacttgctacatgagcgaattgttcag
tattatggctgtttgagggatccccaggaaaaaacactttccatatttatggaatatatg
ccagggggttcaattaaggaccaattaaaagcatatggcgctcttactgagaatgtgact
aggaaatacacccgtcagattctggagggtgtccattatttgcacagtaatatgattgtc
catagagatatcaaaggcgcaaatatcctgcgagattcaacaggcaacgtcaaactagga
gattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaagtct
gtcacaggcacaccatactggatgagccctgaagtcatcagtggagaaggctatggaaga
aaagcagacatctggagtgttgcatgtactgtggtagaaatgctaactgaaaagccgcct
tgggctgaatttgaagcaatggctgccatctttaaaatcgccactcagccaacaaaccca
aagctgccacctcatgtctcagactatactcgagatttcctcaaacagatttttgtagag
gccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcattatcactag

DBGET integrated database retrieval system