KEGG   Pongo abelii (Sumatran orangutan): 100450292Help
Entry
100450292         CDS       T01416                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04024  cAMP signaling pathway
pon04137  Mitophagy - animal
pon04210  Apoptosis
pon04310  Wnt signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04530  Tight junction
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04932  Non-alcoholic fatty liver disease (NAFLD)
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease (American trypanosomiasis)
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05224  Breast cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05321  Inflammatory bowel disease (IBD)
pon05323  Rheumatoid arthritis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450292 (JUN)
   04012 ErbB signaling pathway
    100450292 (JUN)
   04310 Wnt signaling pathway
    100450292 (JUN)
   04668 TNF signaling pathway
    100450292 (JUN)
   04024 cAMP signaling pathway
    100450292 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100450292 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    100450292 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100450292 (JUN)
   04530 Tight junction
    100450292 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100450292 (JUN)
   04621 NOD-like receptor signaling pathway
    100450292 (JUN)
   04625 C-type lectin receptor signaling pathway
    100450292 (JUN)
   04660 T cell receptor signaling pathway
    100450292 (JUN)
   04658 Th1 and Th2 cell differentiation
    100450292 (JUN)
   04659 Th17 cell differentiation
    100450292 (JUN)
   04657 IL-17 signaling pathway
    100450292 (JUN)
   04662 B cell receptor signaling pathway
    100450292 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100450292 (JUN)
   04915 Estrogen signaling pathway
    100450292 (JUN)
   04921 Oxytocin signaling pathway
    100450292 (JUN)
   04926 Relaxin signaling pathway
    100450292 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100450292 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100450292 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450292 (JUN)
   05203 Viral carcinogenesis
    100450292 (JUN)
   05231 Choline metabolism in cancer
    100450292 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100450292 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100450292 (JUN)
   05211 Renal cell carcinoma
    100450292 (JUN)
   05224 Breast cancer
    100450292 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100450292 (JUN)
   05321 Inflammatory bowel disease (IBD)
    100450292 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    100450292 (JUN)
   05031 Amphetamine addiction
    100450292 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100450292 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100450292 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100450292 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100450292 (JUN)
   05135 Yersinia infection
    100450292 (JUN)
   05133 Pertussis
    100450292 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100450292 (JUN)
   05170 Human immunodeficiency virus 1 infection
    100450292 (JUN)
   05162 Measles
    100450292 (JUN)
   05161 Hepatitis B
    100450292 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100450292 (JUN)
   05169 Epstein-Barr virus infection
    100450292 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100450292 (JUN)
   05142 Chagas disease (American trypanosomiasis)
    100450292 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100450292 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100450292 (JUN)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100450292 (JUN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha Jnk-SapK_ap_N FlaC_arch NBP1 TSC22 DUF3450 TFIIA
Motif
Other DBs
NCBI-GeneID: 100450292
NCBI-ProteinID: XP_002810809
Ensembl: ENSPPYG00000001295
UniProt: H2N785
LinkDB All DBs
Position
1
AA seq 334 aa AA seqDB search
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgtgcgaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggcg
ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggtggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcagccgccgcaccacctgccccagcagatgcccgtg
cagcacccgcggctgcaggccctgaaggaggagcctcagacagtgcccgagatgccgggc
gagacaccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system