KEGG   Pongo abelii (Sumatran orangutan): 100450587
Entry
100450587         CDS       T01416                                 

Gene name
SLC7A3
Definition
(RefSeq) cationic amino acid transporter 3 isoform X2
  KO
K13865  solute carrier family 7 (cationic amino acid transporter), member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100450587 (SLC7A3)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100450587 (SLC7A3)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C O-antigen_lig MSP1a
Other DBs
NCBI-GeneID: 100450587
NCBI-ProteinID: XP_002831817
Ensembl: ENSPPYG00000020442
UniProt: A0A6D2WA03 A0A2J8UBJ1
LinkDB
Position
X
AA seq 619 aa
MPWQAFRRFGQKLVRRRTLESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKD
KAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILS
YVIGTASVARAWSSAFDNLIGNHISKTLQGSIALHVPHVLAEYPDFFALGLVLLLTGLLA
LGASESALVTKVFTGVNLLVLGFVMISGFIKGDLHNWKLTEEDYELAMAELNDTYSLGPL
GSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYF
GVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVI
YAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSL
VSICVLILRYQPDQETKAGEEVELQEDAITTESEKLTLWGLFFPLNSIPTPLSGQVVYVC
SSLLAVLLTALCLVLAQWSVPLLSGDLVWTSVVVLLLLLIIGITVVIWRQPQSSTPLHFK
VPALPLLPLMSIFVNIYLMMQMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSR
KSRAKTVDLDPGTLYVHSV
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgccgtggcaagcatttcgcagatttggtcaaaagctggtacgcagacgtacactggag
tcaggcatggctgagactcgccttgccagatgcctaagcaccctggatttagtggccctg
ggtgtgggtagcacattgggtgcaggggtgtatgtcctggctggcgaggtggccaaagat
aaagcagggccatccattgtgatctgctttttggtggctgccctgtcttctgtgttggct
gggctgtgctatgcggagtttggtgcccgggttccccgttctggttctgcatatctctac
agctatgtcactgtgggtgaactctgggccttcaccactggctggaacctcatcctctcc
tatgtcattggtacagccagtgtggcccgggcctggagctctgcttttgacaacctgatt
gggaatcacatctctaagactctgcaggggtccattgcactgcacgtgccccatgtcctt
gcagaatatccagatttctttgctttgggcctcgtgttgctgctcactggattgttggct
ctcggggctagtgagtcggccctggttaccaaagtgttcacaggcgtgaaccttttggtt
cttgggttcgtcatgatctctggcttcattaagggggacctgcacaactggaagctcaca
gaagaggactacgaattggccatggctgaactcaatgacacctatagcttgggtcctcta
ggctctggaggatttgtgcctttcggcttcgagggaattctccgtggagcagcgacctgt
ttctatgcatttgttggtttcgactgtattgctaccaccggagaagaagcccagaatccc
cagcgttccatcccgatgggcattgtgatctcactgtctgtctgctttttggcgtatttt
ggtgtctcttctgcactcaccctcatgatgccttactaccagcttcagcctgagagccct
ttgcctgaggcatttctctacattggatgggctcctgcccgctatgttgtggctgttggc
tccctctgtgctctttctaccagcctcctgggctccatgttccccatgcctcgggtgatc
tacgcgatggcagaggatggcctcctgttccgtgtacttgctcggatccacaccggcaca
cgcaccccaatcatagccaccgtggtctctggcattattgcagcattcatggcattcctc
ttcaaactcactgatcttgtggacctcatgtcaattgggaccctgcttgcttactccctg
gtgtcgatttgtgttctcatcctcaggtatcagcctgatcaggagacaaaggctggggaa
gaagtggagttgcaggaggatgcaataactactgaatcagagaagttgaccctatgggga
ttatttttcccactcaactccatccccactccactctctggccaagttgtctatgtttgt
tcctcattgcttgctgtcctgctgactgctctttgcctggtgctggcccagtggtcagtt
ccattgctttctggagacctagtgtggacttcagtggttgtgctgctcctgctgctcatt
attgggatcactgtggtcatctggagacagccacagagctccactccccttcactttaag
gtgcctgctttgcctctcctcccactaatgagcatctttgtgaatatttaccttatgatg
cagatgacagctggtacctgggcccgatttggggtctggatgctgattggctttgctatc
tacttcggctatgggatccagcacagcctggaagagattaagagtaaccaaccctcacgc
aagtctagagccaaaactgtagaccttgatcccggcactctctatgtccactcagtttga

DBGET integrated database retrieval system