KEGG   Pongo abelii (Sumatran orangutan): 100450682
Entry
100450682         CDS       T01416                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04071  Sphingolipid signaling pathway
pon04115  p53 signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04722  Neurotrophin signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100450682 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100450682 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100450682 (BAX)
   04215 Apoptosis - multiple species
    100450682 (BAX)
   04217 Necroptosis
    100450682 (BAX)
   04115 p53 signaling pathway
    100450682 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100450682 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100450682 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450682 (BAX)
   05202 Transcriptional misregulation in cancer
    100450682 (BAX)
   05203 Viral carcinogenesis
    100450682 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100450682 (BAX)
   05212 Pancreatic cancer
    100450682 (BAX)
   05225 Hepatocellular carcinoma
    100450682 (BAX)
   05226 Gastric cancer
    100450682 (BAX)
   05214 Glioma
    100450682 (BAX)
   05216 Thyroid cancer
    100450682 (BAX)
   05220 Chronic myeloid leukemia
    100450682 (BAX)
   05217 Basal cell carcinoma
    100450682 (BAX)
   05218 Melanoma
    100450682 (BAX)
   05213 Endometrial cancer
    100450682 (BAX)
   05224 Breast cancer
    100450682 (BAX)
   05222 Small cell lung cancer
    100450682 (BAX)
   05223 Non-small cell lung cancer
    100450682 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100450682 (BAX)
   05014 Amyotrophic lateral sclerosis
    100450682 (BAX)
   05016 Huntington disease
    100450682 (BAX)
   05020 Prion disease
    100450682 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    100450682 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100450682 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100450682 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100450682 (BAX)
   05152 Tuberculosis
    100450682 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100450682 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100450682 (BAX)
   05161 Hepatitis B
    100450682 (BAX)
   05160 Hepatitis C
    100450682 (BAX)
   05164 Influenza A
    100450682 (BAX)
   05162 Measles
    100450682 (BAX)
   05168 Herpes simplex virus 1 infection
    100450682 (BAX)
   05163 Human cytomegalovirus infection
    100450682 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100450682 (BAX)
   05169 Epstein-Barr virus infection
    100450682 (BAX)
   05165 Human papillomavirus infection
    100450682 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100450682 (BAX)
   01524 Platinum drug resistance
    100450682 (BAX)
   01522 Endocrine resistance
    100450682 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pon03029]
    100450682 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100450682 (BAX)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100450682 (BAX)
Transporters [BR:pon02000]
 Other transporters
  Pores ion channels [TC:1]
   100450682 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100450682
NCBI-ProteinID: XP_024092718
LinkDB
Position
19
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgcccgaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatcttcgtggctggagta
ctcaccgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system