KEGG   Pongo abelii (Sumatran orangutan): 100450850Help
Entry
100450850         CDS       T01416                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100450850 (MGAM)
   00500 Starch and sucrose metabolism
    100450850 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100450850 (MGAM)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100450850 (MGAM)
    3.2.1.20  alpha-glucosidase
     100450850 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100450850
NCBI-ProteinID: XP_024106152
LinkDB All DBs
Position
7
AA seq 1865 aa AA seqDB search
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTASI
QPRTTSPPDPGTTGTTHPRTTGPLDPGTTATTPVSAECPVVNELERINCIPDQPPTKATC
DQRGCCWNPQGAVSVPWCYYSKNHSYHMEGDLVNTNAGFTARLKNLPSSPVFGSNVDNVL
LTAEYQTSNRFHFKLTDQNNNRFEVPHEHVQSFSGNAASSLIYQVEISREPFSIKVTRRS
NNRVLFDSSIGPLLFADQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTP
NGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFL
GNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHA
DIDYMDERRDFTYDPVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGS
DMKIWVNSSGGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNE
VSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAV
ATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIP
MVGADICGFALDAPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSVLLNSSRHY
LNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDE
GAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLA
SRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYK
DPNNLVFNEIKIVGTEEPGNVTVKHNGVPSQTSPTVTYDSNLKVAIITDINLFLGEAYTV
EWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSDVQYNS
HGATADISLKSSVYASAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPS
VPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLY
GFGETEHRSYKRDLEWHTWGIFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNA
MDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYG
YQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRV
ILILDPAISGNETQPYPAFTRGMEDDVFIKYPNDGDIVWGKVWPDFPDVFVNGSLDWDSQ
VELYRAYVAFPDFFRNSTAKWWKREIEELYNSPQNPERSLKFDGMWIDMNEPSSFVNGAV
SPGCREASLNHPPYMPHLESRERGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRP
TYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYT
GADICGFFEDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRNVLQTR
YTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLELNARN
VTAYFPRARWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQK
FMGFKIALDDEGTAEGWLFWDDGQSIDTYGKGLYYLANFSASQNTMQSHIIFNNYITGTN
PLKLGYIEIWGVGSVPITSVSISVSGMVITPSFNNDPTTQVLSIDVTDRNISLHNFTSLT
WISTL
NT seq 5598 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
cttgtgttgtttatcatcagtattgttctaattgtgcttttagccaaagagtcactgaaa
tcaacagccccagatcccgggacaactggtaccccagatcctggaacaactgcttccata
cagcctaggacaaccagtcccccagatcctggaacaactggtaccacacatcctaggaca
acgggtcccctagatcctggaacaactgctaccactcctgtttctgctgaatgtccagtg
gtaaatgaattggaacgaattaattgcatccctgaccagccaccaacaaaggccacatgt
gaccaacgtggctgttgctggaatccccagggagctgtaagtgttccctggtgctactat
tccaagaatcatagctaccacatggagggcgaccttgtaaacacaaatgcaggattcaca
gcccggttgaaaaatctgccttcttcacccgtgtttggaagcaatgttgacaatgttctt
ctcacagcagaatatcagacatctaatcgtttccactttaagttgaccgaccaaaacaat
aacaggtttgaagtgccccacgaacatgtgcagtccttcagtggaaatgctgcttcttct
ttgatctaccaagttgaaatctccagagagccatttagcatcaaagtgaccagaagaagc
aacaatcgtgttttgtttgactcgagcattggacccctactgtttgctgaccagttcttg
cagctctccactcgactgcctagcgctaacgtgtatggcctgggagagcatgtgcaccag
cagtatcggcatgatatgaattggaagacctggcccatatttaacagggatacaactccc
aatggaaatggaactaatttgtatggtgcacagacattcttcttgtgccttgaagacgct
agtggattgtcctttggggtgtttctgatgaacagcaatgccatggaggttgtccttcag
cctgcgccagcgatcacttaccgcaccattgggggcattctcgacttctatgtgttcttg
ggaaacactccagagcaagttgttcaagaatatctggagcttattgggcggccagccctt
ccctcctactgggcgcttggatttcacctcagtcgttacgaatatggaaccttagacaac
atgagggaagtcgtggagagaaatcgcgcagcacagctcccttatgatgttcagcatgct
gatattgattatatggatgagagaagggacttcacttacgatccagtggattttaaaggc
ttccctgaatttgtcaacgagttacacaataatggacagaagcttgtcatcattgtggat
ccagccatctccaacaactcttcctcaagtaaaccctatggcccatatgacaggggttca
gatatgaagatatgggtgaatagttcgggtggagtgactccactcattggggaggtctgg
cctggacaaactgtgtttcctgattataccaatcccaactgtgctgtttggtggacaaag
gaatttgagctttttcacaatcaagtggagtttgatggaatctggattgatatgaatgaa
gtctccaactttgttgatggttcggtctcaggatgttccacaaacaacctaaataatccc
ccattcactcccagaatcctggatgggtacctgttctgcaagactctctgtatggatgca
gtgcagcactggggcaagcagtatgacgttcacaatctgtatggctactccatggcggtc
gccacagcagaagctgccaagactgtgttccctaataagagaagcttcattctgacccgt
tctacctttgcgggctctggcaagtttgcagcacattggttaggagacaacactgccacc
tgggacgacctgagatggtccatccctggcgtgcttgagttcaaccttttcggcatccca
atggtgggtgctgacatatgtggctttgccttggatgcccctgaggagctctgtaggcgg
tggatgcagttgggtgcattttatccattttctagaaatcacaatggccaaggctacaag
gaccaggatcctgcctcctttggagctgactccgtgctgttgaattcctccaggcactac
cttaacatccgctatactctattgccctacctatacaccctcttcttccgtgctcacagc
cgaggggacacggtggccaggccccttttgcatgagttctatgaggacaacagcacttgg
gatgtgcaccaacagttcttatgggggcccggcctcctcatcactccagttctggatgaa
ggtgcagagaaagtgatggcatatgtgcctgatgctgtctggtatgactacgagactggg
agccaagtgagatggaggaagcaaaaagtcgagatggaacttcctggagacaaaattgga
cttcaccttcgaggaggctacatcttccccacacagcagccaaatacaaccactctggcc
agtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaagaagcaaaagga
gaacttttctgggatgatggggaaacaaaggatactgtggccaataaagtgtatctttta
tgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaatcaacctacaag
gaccccaataatttagtattcaatgagattaaaattgttgggacagaggaacctggaaat
gttacagtaaaacacaatggtgtcccaagtcagacttctcctacagtcacttatgattct
aatctgaaggttgccattatcacagacatcaatcttttcctgggagaagcatacacagtg
gagtggagcataaagataagggatgaagaaaaaatagactgttaccctgatgagaatggt
gcttctgcagaaaactgcactgcccgtggctgtatctgggaggcatccaattcttctgga
gtccctttttgctattttgtcaacgacctatactctgtcagtgatgttcagtataattcc
cacggggccacagctgacatctccttaaagtcttctgtttatgccagtgccttcccctcc
acgcccgtgaacccccttcgcctggatgtcacttaccataagaatgaaatgctgcagttc
aagatttatgatcccaacaacaatcggtatgaagttccagtccctctgaacatacccagc
gtgccttccagcacccctgagggtcaactctatgatgtcctcattaagaagaatccattt
gggattgaaattcgccggaagagtacaggaactataatttgggactctcagctccttggc
ttcaccttcaatgacatgtttatccgtatctccacccgccttccctccaagtacctctac
ggctttggggaaactgagcacaggtcctataagagagacttggagtggcacacttggggg
atattctcccgagaccagcccccagggtacaagaagaattcctatggtgtccacccctac
tacatggggctggaggaggatggcagtgcccatggagtactcctgctgaacagcaatgcc
atggatgtgacgttccagcccctgcctgccttgacataccgtaccacagggggagttctg
gacttttatgtgttcttggggccgactccagagcttgtcacccagcaatacactgagttg
attggccggcctgtgatggtaccttactggtctttggggttccagctatgtcgctatggc
taccagaacgactctgagatcgccagcttgtatgatgagatggtggctgcccagatccct
tatgacgtgcagtactcagacatcgactacatggagcggcagctggacttcaccctcagc
cccaagtttgctgggtttccagctctgatcaatcgcatgaaggctgatgggatgcgggtc
atcctcattctggatccagccatttctggcaatgagacacagccctatcctgccttcact
cggggcatggaggatgacgtcttcatcaaatacccaaatgatggagacattgtctgggga
aaggtctggcctgattttcctgatgtttttgtgaatgggtctctagactgggacagtcaa
gtggagctatatcgagcttatgtggccttcccagactttttccgtaattcaactgccaag
tggtggaagagggaaatagaagaactatacaacagtccacagaatccagagaggagcttg
aagtttgatggcatgtggattgatatgaatgaaccatcaagcttcgtgaatggggcagtt
tctccaggctgcagggaagcctctcttaaccaccctccctacatgccacatttggagtcc
agggagaggggcctgagcagcaagaccctgtgcatggagagtcagcagatcctcccagac
ggctccctggtgcagcactacaacgtgcacaacctgtacgggtggtcccagaccagaccc
acatatgaagccgtgcaggaggtgacaggacagcgaggggttgtcatcacccgctccacg
tttccctcttctggccgctgggcagggcattggctgggagacaacacagccgcatgggat
cagctgaagaaatctatcattggcatgatggagttcagcctcttcggcatatcctataca
ggagcagatatctgtgggttctttgaagatgctgaatatgagatgtgtgttcgctggatg
cagctgggggccttttaccccttctcaagaaaccacaacaccattgggaccaggagacaa
gaccctgtgtcctgggatgctgcttttgtgaatatttccagaaatgtcctgcagaccaga
tacaccctgttgccatatctgtataccttgatgcataaggcccacacggagggcgtcact
gttgtgcggcctctgctccacgagtttgtgtcagaccaggtgacatgggacatagacagt
cagttcctgctgggcccagccttcctggtcagccctgtcctggagctcaatgccagaaat
gtcactgcatatttccctagagcccgctggtacgattactacacgggtgtggatattaat
gcaagaggagagtggaagaccttgccagcccctcttgaccacattaatcttcatgtccgt
gggggctacatcctgccctggcaagagcctgcactgaacacccacttaagccgccagaaa
ttcatgggcttcaaaattgccttggatgatgagggaactgctgagggctggctcttctgg
gatgatgggcaaagcatagatacctatgggaaaggactctattacttggccaacttttct
gccagccagaatacgatgcaaagccatataattttcaacaattacatcactggtacaaat
cctttgaaactgggctacattgaaatctggggagtcggcagtgtccccattaccagtgtc
agcatctctgtgagcggcatggtcataacaccctccttcaacaatgaccccacgacacag
gtattaagcatcgatgtgactgacagaaacatcagcctacataattttacttcgttgaca
tggataagcactctgtga

DBGET integrated database retrieval system