KEGG   Pongo abelii (Sumatran orangutan): 100450890Help
Entry
100450890         CDS       T01416                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04218  Cellular senescence
pon04670  Leukocyte transendothelial migration
pon05200  Pathways in cancer
pon05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100450890 (RASSF5)
   04015 Rap1 signaling pathway
    100450890 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100450890 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100450890 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450890 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100450890 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Motif
Other DBs
NCBI-GeneID: 100450890
NCBI-ProteinID: XP_024104712
Ensembl: ENSPPYG00000000286
LinkDB All DBs
Position
1
AA seq 418 aa AA seqDB search
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPEPPPPPPDRSSRLCVPAPLSTAPGAREGR
STRRAARGNLEPPPRASRPARPPRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHGFAELVLPGGPGWCDLCGREVLRQALRCVNCKFTCHPECRSLIQLDCSQQEGLSWDR
PSPESTLTLTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAMKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtacccgctactcttggaccccgag
ccgccgcgctatttacagagcctgagcggcccggagccgccgccgccgccccccgaccgg
tcctcgcgcctctgtgtccctgcgcccctctccactgcgccaggggcgcgcgaggggcgc
agcacccggagggctgcccgggggaacctggagcccccgccccgggcctcccgacccgct
cgcccgccccggcctggtctgcagcagagactgcggcggcggcctggagcgccccgaccc
cgcgacgtgcggagcatcttcgagcagccgcaggatcccagagtcccggcggagcgaggc
gaggggcacggcttcgccgagttggtgctgccgggcggccccggctggtgtgacctgtgc
ggacgagaggtgctgcggcaggcgctgcgctgcgttaactgtaaattcacctgtcaccca
gaatgccgcagcctgatccagttggactgcagtcagcaggagggtttatcctgggacaga
ccctctccagaaagcaccctcaccctgaccttcagccagaatgtctgtaaacctgtggag
gagacacagcgcccacccacactgcaggagatcaagcagaagattgacagctacaacacg
cgagagaagaactgcctgggcatgaaactgagtgaagatggcacctacacgggtttcatc
aaagtgcatctaaaactccggcggcctgtgacagtgcctgctgggatccggccccagtcc
atctatgatgccatgaaggaggtgaacctggcggctaccacggacaagcggacatccttc
tacctgcccctagatgccatcaagcagctgcacatcagcagcaccaccaccgtcagtgag
gtcatccaggggctgctcaagaagttcatggttgtggacaatccccagaagtttgcactt
tttaagcggatacacaaggacggacaagtgctcttccagaaactctccattgctgaccgc
cccctctacctgcgcctgcttgctgggcctgacacggaggtcctcagctttgtgctaaag
gagaatgaaactggagaggtggagtgggatgccttctccatccctgaacttcagaacttc
ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaagtatgac
aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa

DBGET integrated database retrieval system